Citrus Sinensis ID: 022284

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30

MYSPAFYAACTAGGTLSCGLTHTAVTPLDLVKCNMQIDPAKYKSITSGFGVLLKEQGLKGFFRGWVPTLFGYSAQGACKFGFYEFFKKYYSDIAGPEYAAKYKTLIYLAGSASAELIADVALCPMEAVKVRVQTQPGFARGLGDGLPKFLKSDGVSGLYKGLVPLWGRQIPYTMMKFASFETIVEMLYKYAIPTPKEQCSKSLQLGVSFAGGYVAGVFCAVVSHPADNLVSFLNNAKGASVGDAVKKMGLWGLCTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGLPTTGGAAPPPAEKA

cccHHHHHHHHHHHHHHHHHHHccccccHHHHHHccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccccHHHHHHHHHHHccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHcccHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc

*YSPAFYAACTAGGTLSCGLTHTAVTPLDLVKCNMQIDPAKYKSITSGFGVLLKEQGLKGFFRGWVPTLFGYSAQGACKFGFYEFFKKYYSDIAGPEYAAKYKTLIYLAGSASAELIADVALCPMEAVKVRVQTQPGFARGLGDGLPKFLKSDGVSGLYKGLVPLWGRQIPYTMMKFASFETIVEMLYKYAIPTPKEQCSKSLQLGVSFAGGYVAGVFCAVVSHPADNLVSFLNNAKGASVGDAVKKMGLWGLCTRGLPLRIVMIGTLTGAQWGIYDAFKVFVGLPT************

xxxxxxxHHHHHxxHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHxxHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable mitochondrial phosphate carrier protein	Transport of phosphate groups from the cytosol to the mitochondrial matrix.	probable	Q9P7V8
Mitochondrial phosphate carrier protein 3, mitochondrial	Transport of phosphate groups from the cytosol to the mitochondrial matrix. Mediates salt stress tolerance through an ATP-dependent pathway and via modulation of the gibberellin metabolism.	probable	Q9FMU6
Phosphate carrier protein, mitochondrial	Transport of phosphate groups from the cytosol to the mitochondrial matrix. Phosphate is cotransported with H(+).	probable	P12234

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OKC, chain A
Confidence level:very confident
Coverage over the Query: 4-190,201-279
View the alignment between query and template
View the model in PyMOL