Citrus Sinensis ID: 022333


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MASLTSVAFTSIGQTSCQRKVNVSSTRSLVSNFEGFRFRTSLFCHCVRFRASSSSSRMIIQCMSTATDVPPTVAETKMNFLKLYKRPIPSIYNTVLQELIVQQHLMRYKRTYQYDPVFALGFVTVYDRLMEGYPSEEDREAIFQAYITALKEDPEQYRIDAQKLEEWARGQTASSLVEFPSKEGEVEGLLKDIAERASGKGNFSYSRFFAVGLFRLLELANATEPTVLEKLCAVLNVNKRSVDRDLDVYRNLLSKLLQAKELLKEYVDREKKKREERTEPQKANEAIKKCLGEYLYSHQ
ccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccc
********FTSI******************SNFEGFRFRTSLFCHCVRFRASSSSSRMIIQCMSTATDVPPTVAETKMNFLKLYKRPIPSIYNTVLQELIVQQHLMRYKRTYQYDPVFALGFVTVYDRLMEGYPSEEDREAIFQAYITALKEDPEQYRIDAQKL*EW*********************LLKDIAERASGKGNFSYSRFFAVGLFRLLELANATEPTVLEKLCAVLNVNKRSVDRDLDVYRNLLSKLLQAKELLKEY***********************CLGE******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASLTSVAFTSIGQTSCQRKVNVSSTRSLVSNFEGFRFRTSLFCHCVRFRASSSSSRMIIQCMSTATDVPPTVAETKMNFLKLYKRPIPSIYNTVLQELIVQQHLMRYKRTYQYDPVFALGFVTVYDRLMEGYPSEEDREAIFQAYITALKEDPEQYRIDAQKLEEWARGQTASSLVEFPSKEGEVEGLLKDIAERASGKGNFSYSRFFAVGLFRLLELANATEPTVLEKLCAVLNVNKRSVDRDLDVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPQKANEAIKKCLGEYLYSHQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein THYLAKOID FORMATION1, chloroplastic Involved in a dynamic process of vesicle-mediated thylakoid membrane biogenesis. Required for the normal organization of vesicles into mature thylakoid stacks and ultimately for leaf development.probableQ84PB7
Protein THYLAKOID FORMATION 1, chloroplastic Involved in a dynamic process of vesicle-mediated thylakoid membrane biogenesis. Required for the normal organization of vesicles into mature thylakoid stacks and ultimately for leaf development. Also involved in a sugar-signaling mechanism in roots by mediating signaling between the plasma membrane and the plastid. Probably acts downstream of the plasma membrane-delimited heterotrimeric G-protein GPA1 in a D-glucose signaling pathway.probableQ9SKT0
Protein THYLAKOID FORMATION1, chloroplastic Involved in a dynamic process of vesicle-mediated thylakoid membrane biogenesis. Required for the normal organization of vesicles into mature thylakoid stacks and ultimately for leaf development.probableQ7XAB8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!