Citrus Sinensis ID: 022374


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MASAPSKLYSDDVSLVVVLLDTNPFFWSSSSLSFSQFLTHVLAFLNAILTLNQLNQVVVIATGYNSCDYVYDSSSTGNQSVGNGRMPSLCATLLQNLEEFMNKDEQLGKQEPEGRIACSLLSGSLSMALCYIQRVFRSGLLHPQPRILCLQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCYLGAQNSAFLQQASYITGGVHHKPQQLDGLFQYLLTIFGTDLHSRNFLQLPKPVGVDFRASCFCHKNTIDMGYICSVCLSIYCKHLKKCSTCGSVFGQAQTQSDEPSATNRKRKTTDA
ccccccccccccccEEEEEEEcccHHHccccccHHHHHHHHHHHHHHHHHccccccEEEEEEcccccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccHHHHHHHHHHHHHcccCEEEEEEEcccccHHHHHHHHHccccccccccHHHHHHHHHHHHccccHHHccccccccccccccEEEccccccccEEEEccccccEEcccccccccccccccccccccccccccccccccccc
***********DVSLVVVLLDTNPFFWSSSSLSFSQFLTHVLAFLNAILTLNQLNQVVVIATGYNSCDYVYD****************LCATLLQNLE****************RIACSLLSGSLSMALCYIQRVFRSGLLHPQPRILCLQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCYLGAQNSAFLQQASYITGGVHHKPQQLDGLFQYLLTIFGTDLHSRNFLQLPKPVGVDFRASCFCHKNTIDMGYICSVCLSIYCKHLKKCSTCGSVFG*********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASAPSKLYSDDVSLVVVLLDTNPFFWSSSSLSFSQFLTHVLAFLNAILTLNQLNQVVVIATGYNSCDYVYDSSSTGNQSVGNGRMPSLCATLLQNLEEFMNKDEQLGKQEPEGRIACSLLSGSLSMALCYIQRVFRSGLLHPQPRILCLQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCYLGAQNSAFLQQASYITGGVHHKPQQLDGLFQYLLTIFGTDLHSRNFLQLPKPVGVDFRASCFCHKNTIDMGYICSVCLSIYCKHLKKCSTCGSVFGQAQTQSDEPSATNRKRKTTDA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
General transcription factor IIH subunit 3 Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. Anchors XPB.probableQ8VD76
RNA polymerase II transcription factor B subunit 4 Acts as component of the general transcription and DNA repair factor IIH (TFIIH) core, which is essential for both basal and activated transcription, and is involved in nucleotide excision repair (NER) of damaged DNA. TFIIH has CTD kinase and DNA-dependent ATPase activity, and is essential for polymerase II transcription in vitro.probableQ12004
RNA polymerase II transcription factor B subunit 4 Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA. Has a role in the initiation of transcription.probableO74366

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IBS, chain A
Confidence level:confident
Coverage over the Query: 12-77,91-216
View the alignment between query and template
View the model in PyMOL
Template: 2ODP, chain A
Confidence level:probable
Coverage over the Query: 11-218
View the alignment between query and template
View the model in PyMOL
Template: 2LCQ, chain A
Confidence level:probable
Coverage over the Query: 247-280
View the alignment between query and template
View the model in PyMOL