BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 022403
         (297 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3LZC|A Chain A, Crystal Structure Of Dph2 From Pyrococcus Horikoshii
 pdb|3LZC|B Chain B, Crystal Structure Of Dph2 From Pyrococcus Horikoshii
 pdb|3LZD|A Chain A, Crystal Structure Of Dph2 From Pyrococcus Horikoshii With
           4fe-4s Cluster
 pdb|3LZD|B Chain B, Crystal Structure Of Dph2 From Pyrococcus Horikoshii With
           4fe-4s Cluster
          Length = 378

 Score = 27.7 bits (60), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 18/37 (48%)

Query: 11  SKLSSCDAYFEAIQSRKKLPHSLQETLTAAFARIPVL 47
           +KL  CDA      S  KLP  +      AFAR+ V+
Sbjct: 102 AKLVGCDALIHLGHSYMKLPLEVPTIFVPAFARVSVV 138


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.134    0.394 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,511,966
Number of Sequences: 62578
Number of extensions: 219984
Number of successful extensions: 489
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 483
Number of HSP's gapped (non-prelim): 6
length of query: 297
length of database: 14,973,337
effective HSP length: 98
effective length of query: 199
effective length of database: 8,840,693
effective search space: 1759297907
effective search space used: 1759297907
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)