Citrus Sinensis ID: 022425

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------
MSSRSSRTLYVGNLPGDTRMREVEDLFYKYGPIVDIDLKIPPRPPGYAFLEFEDYRDAEDAIRGRDGYNFDGYRLRVELAHGGRRHSSSMDRYSSYSSGGSRGVSRRSDYRVLVTGLPSSASWQDLKDHMRRAGDVCFSQVFRDRGGMTGIVDYTSYDDMKYAIRKLDRSEFRNAFSRSYVRVREYDSRRSYSRSPSRSPYYSRSRSRSPYYSRSRSPSRSWSYSPRSRSYSPRGKYSRRSPSLSPARSASQRSPSGSPPRSFSRSRSRSSSPLSSPRSPRGRSRSRTRSISRSLSP
cccccccEEEEccccccccHHHHHHHHHcccccEEEEEccccccccEEEEEEccHHHHHHHHHHccccccccccEEEEEccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHcccccEEEccEEccccccEEEEcccHHHHHHHHHHccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
*****SR**YVGNLPGDTRMREVEDLFYKYGPIVDIDLKIPPRPPGYAFLEFEDYRDAEDAIRGRDGYNFDGYRLRVELAH**********************VSRRSDYRVLVTGLPSSASWQDLKDHMRRAGDVCFSQVFRDRGGMTGIVDYTSYDDMKYAIRKLDRSEFRNAFSRSYVRV******************************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSRSSRTLYVGNLPGDTRMREVEDLFYKYGPIVDIDLKIPPRPPGYAFLEFEDYRDAEDAIRGRDGYNFDGYRLRVELAHGGRRHSSSMDRYSSYSSGGSRGVSRRSDYRVLVTGLPSSASWQDLKDHMRRAGDVCFSQVFRDRGGMTGIVDYTSYDDMKYAIRKLDRSEFRNAFSRSYVRVREYDSRRSYSRSPSRSPYYSRSRSRSPYYSRSRSPSRSWSYSPRSRSYSPRGKYSRRSPSLSPARSASQRSPSGSPPRSFSRSRSRSSSPLSSPRSPRGRSRSRTRSISRSLSP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/arginine-rich splicing factor 1 May play a role in preventing exon skipping, ensuring the accuracy of splicing and regulating alternative splicing.probableQ5ZML3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YH0, chain A
Confidence level:very confident
Coverage over the Query: 6-189
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3h0g, chain Aconfident Alignment | Template Structure