Query         022437
Match_columns 297
No_of_seqs    113 out of 139
Neff          3.8 
Searched_HMMs 46136
Date          Fri Mar 29 03:32:13 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/022437.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/022437hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF11891 DUF3411:  Domain of un 100.0 1.4E-38   3E-43  281.8   8.3   87  161-247    93-179 (180)
  2 PF02979 NHase_alpha:  Nitrile   82.5    0.77 1.7E-05   42.1   1.8   44  117-160    16-67  (188)
  3 COG4907 Predicted membrane pro  81.4    0.98 2.1E-05   46.8   2.3    8   28-35    551-558 (595)
  4 PF02957 TT_ORF2:  TT viral ORF  75.5     8.8 0.00019   31.9   5.9   20   85-104   100-119 (122)
  5 TIGR01323 nitrile_alph nitrile  60.1       7 0.00015   35.9   2.4   44  117-160    10-61  (185)
  6 PLN03138 Protein TOC75; Provis  56.6      19 0.00042   39.5   5.4    6  164-169   178-183 (796)
  7 TIGR03793 TOMM_pelo TOMM prope  46.9     6.5 0.00014   31.1   0.0   17  144-160    14-30  (77)
  8 PLN02705 beta-amylase           38.6      62  0.0013   35.0   5.6    9  109-117    97-105 (681)
  9 KOG4096 Uncharacterized conser  37.7     5.1 0.00011   32.0  -1.8   56  186-241    16-71  (75)
 10 PHA02629 A-type inclusion body  34.9      20 0.00043   27.3   1.0   23   88-110    27-49  (61)
 11 KOG3074 Transcriptional regula  34.9      24 0.00052   33.9   1.8    8  229-236   199-206 (263)
 12 PF07631 PSD4:  Protein of unkn  34.6      38 0.00082   28.9   2.8   33  109-159    17-51  (128)
 13 PF08671 SinI:  Anti-repressor   33.3      41 0.00088   22.5   2.2   22  114-136     9-30  (30)
 14 TIGR03795 chp_BMA0021 conserve  30.7      29 0.00063   29.7   1.5   17  144-160    25-41  (114)
 15 PF14407 Frankia_peptide:  Ribo  30.2      19 0.00041   27.8   0.2   14  146-159    12-25  (61)
 16 KOG3973 Uncharacterized conser  30.1      39 0.00085   34.4   2.5   12   25-36    294-305 (465)
 17 PF10247 Romo1:  Reactive mitoc  26.6      46   0.001   26.0   1.8   52  185-240    15-66  (67)
 18 PHA00370 III attachment protei  26.2 1.2E+02  0.0026   29.7   4.9   26   88-113   143-168 (297)
 19 KOG1456 Heterogeneous nuclear   25.6      28  0.0006   35.8   0.5   11  112-122    46-56  (494)
 20 PHA00370 III attachment protei  25.1      64  0.0014   31.6   2.8    7  241-247   256-262 (297)
 21 TIGR02877 spore_yhbH sporulati  24.6      85  0.0018   31.8   3.7   11   92-102   115-125 (371)
 22 PF12095 DUF3571:  Protein of u  24.4      75  0.0016   25.9   2.7   27   91-117    24-50  (83)
 23 PF10415 FumaraseC_C:  Fumarase  23.0 1.1E+02  0.0025   22.5   3.3   39   94-135    12-50  (55)
 24 COG3028 Uncharacterized protei  21.9 1.1E+02  0.0023   28.4   3.5   28  140-167   113-145 (187)
 25 cd00086 homeodomain Homeodomai  21.8 2.2E+02  0.0049   19.3   4.5   42   93-134     8-50  (59)
 26 PF12244 DUF3606:  Protein of u  21.2 1.5E+02  0.0032   22.0   3.6   36   98-133    21-56  (57)
 27 PF08535 KorB:  KorB domain;  I  20.8      69  0.0015   25.1   1.8   22  106-127    25-46  (93)

No 1  
>PF11891 DUF3411:  Domain of unknown function (DUF3411);  InterPro: IPR021825  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 168 to 186 amino acids in length. This domain has a conserved RYQ sequence motif. 
Probab=100.00  E-value=1.4e-38  Score=281.79  Aligned_cols=87  Identities=53%  Similarity=0.833  Sum_probs=85.4

Q ss_pred             hhccCCCCchhhhHHHHhhcchhhhhhhhhHhhHHHHHHHHHHHHHHhcCcCCCCCCCCCCchhhhhHHHHHhhcchhhH
Q 022437          161 VAFTGTSYSLIQRIGAIVRNGAKLFAVGTSASLVGVGITNALINARKALDTSFAGEAEDVPIISTSVAYGVYMAVSSNLR  240 (297)
Q Consensus       161 ~a~pg~~fsl~qR~aa~v~KGa~l~~VGf~aGlvG~glSN~L~a~RK~~dpsf~~~~~~pPil~tA~~wg~fMGvSSNlR  240 (297)
                      +++||++||++||++||+|||++|++|||+||++|+++||+|+++||++||+||+++++||+++||++||+|||+|||+|
T Consensus        93 ~~~~g~~fsl~qR~~~~~~kg~~l~~VG~~ag~vg~~lsn~L~~~rk~~~~~~e~~~~~ppv~~ta~~~g~fmGvSsNlR  172 (180)
T PF11891_consen   93 KGYPGRSFSLAQRIGAFVYKGAKLAAVGFIAGLVGTGLSNALIAARKKVDPSFEPSVPVPPVLKTALGWGAFMGVSSNLR  172 (180)
T ss_pred             cCCCCCcccHHHHHHHHHHcchHhhhhHHHHHHHHHHHHHHHHHHHHhcCccccCCCCCCCHHHHHHHHHHHHhhhHhHH
Confidence            56799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhh
Q 022437          241 YQVLAGV  247 (297)
Q Consensus       241 YQiL~Gl  247 (297)
                      ||+|||+
T Consensus       173 YQil~Gi  179 (180)
T PF11891_consen  173 YQILNGI  179 (180)
T ss_pred             HHHHcCC
Confidence            9999998


No 2  
>PF02979 NHase_alpha:  Nitrile hydratase, alpha chain;  InterPro: IPR004232 Nitrile hydratases (4.2.1.84 from EC) are bacterial enzymes that catalyse the hydration of nitrile compounds to the corresponding amides. They are used as biocatalysts in acrylamide production, one of the few commercial scale bioprocesses, as well as in environmental remediation for the removal of nitriles from waste streams. Nitrile hydratases are composed of two subunits, alpha and beta, and are normally active as a tetramer, alpha(2)beta(2). Nitrile hydratases contain either a non-haem iron or a non-corrinoid cobalt centre, both types sharing a highly conserved peptide sequence in the alpha subunit (CXLCSC) that provides all the residues involved in coordinating the metal ion. Each type of nitrile hydratase specifically incorporated its metal with the help of activator proteins encoded by flanking regions of the nitrile hydratase genes that are necessary for metal insertion. The Fe-containing enzyme is photo-regulated: in the dark the enzyme is inactivated due to the association of nitric oxide (NO) to the iron, while in the light the enzyme is active by photo-dissociation of NO. The NO is held in place by a claw setting formed through specific oxygen atoms in two modified cysteines and a serine residue in the active site [, ]. The cobalt-containing enzyme is unaffected by NO, but was shown to undergo a similar effect with carbon monoxide [, ]. Fe- and cobalt-containing enzymes also display different inhibition patterns with nitrophenols. Thiocyanate hydrolase (SCNase) is a cobalt-containing metalloenzyme with a cysteine-sulphinic acid ligand that hydrolyses thiocyanate to carbonyl sulphide and ammonia []. The two enzymes, nitrile hydratase and SCNase, are homologous over regions corresponding to almost the entire coding regions of the genes: the beta and alpha subunits of thiocyanate hydrolase were homologous to the amino- and carboxyl-terminal halves of the beta subunit of nitrile hydratase, and the gamma subunit of thiocyanate hydrolase was homologous to the alpha subunit of nitrile hydratase [].  This entry represents the structural domain of the alpha subunit of both iron- and cobalt-containing nitrile hydratases; the alpha subunit is a duplication of two structural repeats, each consisting of 4 layers, alpha/beta/beta/alpha []. This structure is also found in the related protein, the gamma subunit of thiocyanate hydrolase (SCNase).; GO: 0003824 catalytic activity, 0046914 transition metal ion binding, 0006807 nitrogen compound metabolic process; PDB: 2DPP_A 3HHT_A 1V29_A 2ZZD_I 2DXC_F 2DXB_F 2DD5_C 2DD4_C 2ZPH_A 2CYZ_A ....
Probab=82.52  E-value=0.77  Score=42.10  Aligned_cols=44  Identities=36%  Similarity=0.395  Sum_probs=31.7

Q ss_pred             HHHcCCCCHHHHHHHHhcccc---hh--hHhhhh---ccchhhhhccchhhh
Q 022437          117 AIEAGRVPAAIVKRYLELEKS---PV--FRWLLN---FGGFRERLLADDLFL  160 (297)
Q Consensus       117 A~e~G~Vs~~~L~rfl~l~~~---p~--~~~l~r---f~gfR~RlLADP~FL  160 (297)
                      -+|.|.|+++.+.++.+...+   |-  .+.+.|   -|+||+|||+||.=.
T Consensus        16 l~ekg~~~~~~~~~~~~~~~~~~~P~~GarvVArAW~Dp~FK~rLLaD~~aA   67 (188)
T PF02979_consen   16 LIEKGLITPAEVDRIIETYESRVGPRNGARVVARAWTDPAFKARLLADPTAA   67 (188)
T ss_dssp             HHHTTSS-HHHHHHHHHHHHHTSSHHHHHHHHHHHHH-HHHHHHHHHSHHHH
T ss_pred             HHHcCCCCHHHHHHHHHHHHhccCccccceeehhhhCCHHHHHHHHHCHHHH
Confidence            368999999999998887654   43  123333   499999999999855


No 3  
>COG4907 Predicted membrane protein [Function unknown]
Probab=81.43  E-value=0.98  Score=46.79  Aligned_cols=8  Identities=25%  Similarity=0.434  Sum_probs=3.4

Q ss_pred             eccccCCC
Q 022437           28 KNITRQIP   35 (297)
Q Consensus        28 ~~~~~~~~   35 (297)
                      ||-+|--.
T Consensus       551 ~nysr~~~  558 (595)
T COG4907         551 NNYSRSFN  558 (595)
T ss_pred             cchhhhhc
Confidence            44444433


No 4  
>PF02957 TT_ORF2:  TT viral ORF2;  InterPro: IPR004118 This entry represents the Gyroviral VP2 protein and TT viral ORF2.  Torque teno virus (TTV) is a nonenveloped and single-stranded DNA virus that was initially isolated from a Japanese patient with hepatitis of unknown aetiology, and which has since been found to infect both healthy and diseased individuals []. Numerous prevalence studies have raised questions about its role in unexplained hepatitis. ORF2 is a 150 residue protein of unknown function.  Gyroviruses are small circular single stranded viruses, such as the Chicken anaemia virus. The VP2 protein contains a set of conserved cysteine and histidine residues suggesting a zinc binding domain. VP2 may act as a scaffold protein in virion assembly and may also play a role in intracellular signaling during viral replication.
Probab=75.54  E-value=8.8  Score=31.86  Aligned_cols=20  Identities=10%  Similarity=-0.102  Sum_probs=13.0

Q ss_pred             CCCCCCCCHHHHHHHHHHhc
Q 022437           85 DDDAGFHNCTEAIFALAKAG  104 (297)
Q Consensus        85 ~~~~~~~~r~ei~~Vl~e~g  104 (297)
                      .+.+++.+-++++++++++.
T Consensus       100 ~~~~ed~~~~dld~L~aa~~  119 (122)
T PF02957_consen  100 EAAGEDYDEEDLDELFAAAA  119 (122)
T ss_pred             cccccCCChHHHHHHhhhhh
Confidence            33455777777877777653


No 5  
>TIGR01323 nitrile_alph nitrile hydratase, alpha subunit. This model describes both iron- and cobalt-containing nitrile hydratase alpha chains. It excludes the thiocyanate hydrolase gamma subunit of Thiobacillus thioparus, a sequence that appears to have evolved from within the family of nitrile hydratase alpha subunits but which differs by several indels and a more rapid accumulation of point mutations.
Probab=60.09  E-value=7  Score=35.91  Aligned_cols=44  Identities=23%  Similarity=0.257  Sum_probs=32.1

Q ss_pred             HHHcCCCCHHHHHHHHhcccc---hh--hHhhhh---ccchhhhhccchhhh
Q 022437          117 AIEAGRVPAAIVKRYLELEKS---PV--FRWLLN---FGGFRERLLADDLFL  160 (297)
Q Consensus       117 A~e~G~Vs~~~L~rfl~l~~~---p~--~~~l~r---f~gfR~RlLADP~FL  160 (297)
                      -+|.|.|+++.+.+.++....   |.  .+.+.|   -|.||.|||+|..=-
T Consensus        10 l~eKGli~~~~id~~i~~~~~~~gP~nGA~vVArAW~Dp~fk~~Ll~d~~aa   61 (185)
T TIGR01323        10 LKSKGLIPEGAVDQLTSLYENEWGPENGAKVVAKAWVDPEFRALLLKDATAA   61 (185)
T ss_pred             HHHcCCCCHHHHHHHHHHHHhccCCcchhhhhhHHhcCHHHHHHHHhChHHH
Confidence            368999999999888876544   43  223333   499999999998743


No 6  
>PLN03138 Protein TOC75; Provisional
Probab=56.58  E-value=19  Score=39.45  Aligned_cols=6  Identities=33%  Similarity=0.772  Sum_probs=2.7

Q ss_pred             cCCCCc
Q 022437          164 TGTSYS  169 (297)
Q Consensus       164 pg~~fs  169 (297)
                      ||..|+
T Consensus       178 pG~v~t  183 (796)
T PLN03138        178 PGGVYT  183 (796)
T ss_pred             CCCccC
Confidence            444444


No 7  
>TIGR03793 TOMM_pelo TOMM propeptide domain. This model represents a domain that is conserved among a large number of putative thiazole/oxazole-modified microcins (TOMM). Oddly, most of this seqence region appears homologous to nitrile hydratase subunits. This family is expanded especially in Pelotomaculum thermopropionicum SI.
Probab=46.92  E-value=6.5  Score=31.11  Aligned_cols=17  Identities=18%  Similarity=0.180  Sum_probs=14.0

Q ss_pred             hhccchhhhhccchhhh
Q 022437          144 LNFGGFRERLLADDLFL  160 (297)
Q Consensus       144 ~rf~gfR~RlLADP~FL  160 (297)
                      +.-+.||.|||+||.=.
T Consensus        14 w~Dp~Fr~~Ll~DPraa   30 (77)
T TIGR03793        14 WEDEAFKQALLTNPKEA   30 (77)
T ss_pred             HcCHHHHHHHHHCHHHH
Confidence            34699999999999843


No 8  
>PLN02705 beta-amylase
Probab=38.58  E-value=62  Score=35.02  Aligned_cols=9  Identities=0%  Similarity=0.187  Sum_probs=3.5

Q ss_pred             CchHHHHHH
Q 022437          109 DLPKDLAGA  117 (297)
Q Consensus       109 sLP~Dl~~A  117 (297)
                      .+-+.|-.+
T Consensus        97 ai~~ki~ag  105 (681)
T PLN02705         97 AITSRMLAG  105 (681)
T ss_pred             HHHHHHHHH
Confidence            333334333


No 9  
>KOG4096 consensus Uncharacterized conserved protein [Function unknown]
Probab=37.74  E-value=5.1  Score=31.97  Aligned_cols=56  Identities=11%  Similarity=0.176  Sum_probs=30.4

Q ss_pred             hhhhhHhhHHHHHHHHHHHHHHhcCcCCCCCCCCCCchhhhhHHHHHhhcchhhHH
Q 022437          186 AVGTSASLVGVGITNALINARKALDTSFAGEAEDVPIISTSVAYGVYMAVSSNLRY  241 (297)
Q Consensus       186 ~VGf~aGlvG~glSN~L~a~RK~~dpsf~~~~~~pPil~tA~~wg~fMGvSSNlRY  241 (297)
                      .+|+..|..-.++=-....+|-.+.+.---...-.-++.++.++|+||++-+-+||
T Consensus        16 ~mG~avG~a~G~lfGgf~~lR~g~~g~~~vr~iGkt~~~SagtFG~FM~igs~Ir~   71 (75)
T KOG4096|consen   16 MMGGAVGGATGALFGGFAALRYGPRGRGLVRTIGKTMLQSAGTFGLFMGIGSGIRC   71 (75)
T ss_pred             HHHhhhhhhhhhhccchhheeecCChhHHHHHHhHHHHhccchhhhhhhhhhheec
Confidence            34444443333333344455555433210001122366777899999999998887


No 10 
>PHA02629 A-type inclusion body protein; Provisional
Probab=34.94  E-value=20  Score=27.27  Aligned_cols=23  Identities=4%  Similarity=-0.054  Sum_probs=15.8

Q ss_pred             CCCCCHHHHHHHHHHhccccCCc
Q 022437           88 AGFHNCTEAIFALAKAGRTLGDL  110 (297)
Q Consensus        88 ~~~~~r~ei~~Vl~e~gr~~~sL  110 (297)
                      .-+++|+.|.-.-+|.-|.|+.+
T Consensus        27 ~c~ferk~iavleaelr~~meti   49 (61)
T PHA02629         27 SCEFERKIIAVLEAELRKSMETI   49 (61)
T ss_pred             hhHhhHHHHHHHHHHHHHHHHHH
Confidence            56788888776666666666553


No 11 
>KOG3074 consensus Transcriptional regulator of the PUR family, single-stranded-DNA-binding [Transcription]
Probab=34.88  E-value=24  Score=33.94  Aligned_cols=8  Identities=38%  Similarity=0.816  Sum_probs=3.8

Q ss_pred             HHHHhhcc
Q 022437          229 YGVYMAVS  236 (297)
Q Consensus       229 wg~fMGvS  236 (297)
                      ||.||=+|
T Consensus       199 ~G~f~riS  206 (263)
T KOG3074|consen  199 RGVFVRIS  206 (263)
T ss_pred             ccceEEEE
Confidence            44555444


No 12 
>PF07631 PSD4:  Protein of unknown function (DUF1592);  InterPro: IPR013042  A region of similarity shared by several Rhodopirellula baltica cytochrome-like proteins that are predicted to be secreted. These proteins also contain IPR011478 from INTERPRO, IPR013036 from INTERPRO, IPR013039 from INTERPRO and IPR013043 from INTERPRO.
Probab=34.58  E-value=38  Score=28.86  Aligned_cols=33  Identities=30%  Similarity=0.379  Sum_probs=23.3

Q ss_pred             Cch-HHHHHHHHcCCC-CHHHHHHHHhcccchhhHhhhhccchhhhhccchhh
Q 022437          109 DLP-KDLAGAIEAGRV-PAAIVKRYLELEKSPVFRWLLNFGGFRERLLADDLF  159 (297)
Q Consensus       109 sLP-~Dl~~A~e~G~V-s~~~L~rfl~l~~~p~~~~l~rf~gfR~RlLADP~F  159 (297)
                      +.| +.|.+|++.|.+ +++++                  ..-.+|||+||++
T Consensus        17 s~PD~~L~~aA~~g~L~~~~~l------------------~~q~~RML~dpr~   51 (128)
T PF07631_consen   17 SPPDAELLDAAAAGELRTPEQL------------------RAQAERMLADPRA   51 (128)
T ss_pred             CCCCHHHHHHHHhCCCCCHHHH------------------HHHHHHHHcCccH
Confidence            455 678888888887 44443                  3346899999976


No 13 
>PF08671 SinI:  Anti-repressor SinI;  InterPro: IPR010981 The SinR repressor is part of a group of Sin (sporulation inhibition) proteins in Bacillus subtilis that regulate the commitment to sporulation in response to extreme adversity []. SinR is a tetrameric repressor protein that binds to the promoters of genes essential for entry into sporulation and prevents their transcription. This repression is overcome through the activity of SinI, which disrupts the SinR tetramer through the formation of a SinI-SinR heterodimer, thereby allowing sporulation to proceed. The SinR structure consists of two domains: a dimerisation domain stabilised by a hydrophobic core, and a DNA-binding domain that is identical to domains of the bacteriophage 434 CI and Cro proteins that regulate prophage induction. The dimerisation domain is a four-helical bundle formed from two helices from the C-terminal residues of SinR and two helices from the central residues of SinI. These regions in SinR and SinI are similar in both structure and sequence. The interaction of SinR monomers to form tetramers is weaker than between SinR and SinI, since SinI can effectively disrupt SinR tetramers. This entry represents the dimerisation domain in both SinI and SinR proteins.; GO: 0005488 binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1B0N_A 2YAL_A.
Probab=33.30  E-value=41  Score=22.50  Aligned_cols=22  Identities=23%  Similarity=0.451  Sum_probs=15.5

Q ss_pred             HHHHHHcCCCCHHHHHHHHhccc
Q 022437          114 LAGAIEAGRVPAAIVKRYLELEK  136 (297)
Q Consensus       114 l~~A~e~G~Vs~~~L~rfl~l~~  136 (297)
                      |.+|.++ ++|.+.+.+||+.++
T Consensus         9 i~eA~~~-Gls~eeir~FL~~~k   30 (30)
T PF08671_consen    9 IKEAKES-GLSKEEIREFLEFNK   30 (30)
T ss_dssp             HHHHHHT-T--HHHHHHHHHHHH
T ss_pred             HHHHHHc-CCCHHHHHHHHHhCC
Confidence            5677666 589999999998753


No 14 
>TIGR03795 chp_BMA0021 conserved hypothetical protein, BMA_0021 family. Members of this protein family are found sparsely, mostly in members of the genus Burkholderia. Members often occur as tandem homologous genes, such as BMA_0021 and BMA_0022 in Burkholderia mallei ATCC 23344. The genes regularly are encoded near the so-called docking protein of TOMM (thiazole/oxazole-modified microcins) biosynthetic clusters, suggesting a role in bacteriocin biosynthesis. The function is unknown.
Probab=30.75  E-value=29  Score=29.65  Aligned_cols=17  Identities=29%  Similarity=0.366  Sum_probs=14.3

Q ss_pred             hhccchhhhhccchhhh
Q 022437          144 LNFGGFRERLLADDLFL  160 (297)
Q Consensus       144 ~rf~gfR~RlLADP~FL  160 (297)
                      .+.+.||+|||+||.=.
T Consensus        25 W~DpaFr~eLl~DPk~~   41 (114)
T TIGR03795        25 WHSPEFKDELLADPVDA   41 (114)
T ss_pred             hCCHHHHHHHHHCHHHH
Confidence            35799999999999854


No 15 
>PF14407 Frankia_peptide:  Ribosomally synthesized peptide prototyped by Frankia Franean1_4349.
Probab=30.24  E-value=19  Score=27.83  Aligned_cols=14  Identities=43%  Similarity=0.425  Sum_probs=12.1

Q ss_pred             ccchhhhhccchhh
Q 022437          146 FGGFRERLLADDLF  159 (297)
Q Consensus       146 f~gfR~RlLADP~F  159 (297)
                      -++||.||+|||.-
T Consensus        12 D~~FRqqllad~~~   25 (61)
T PF14407_consen   12 DEAFRQQLLADPEE   25 (61)
T ss_pred             CHHHHHHHhcCHHH
Confidence            48899999999986


No 16 
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown]
Probab=30.10  E-value=39  Score=34.41  Aligned_cols=12  Identities=17%  Similarity=-0.031  Sum_probs=6.5

Q ss_pred             ceeeccccCCCC
Q 022437           25 FVIKNITRQIPN   36 (297)
Q Consensus        25 ~~~~~~~~~~~~   36 (297)
                      .|-+.|-|.|..
T Consensus       294 i~k~~igrvPDR  305 (465)
T KOG3973|consen  294 IHKLSIGRVPDR  305 (465)
T ss_pred             hcccccccCCCC
Confidence            344456666653


No 17 
>PF10247 Romo1:  Reactive mitochondrial oxygen species modulator 1;  InterPro: IPR018450 The majority of endogenous reactive oxygen species (ROS) in cells are produced by the mitochondrial respiratory chain. An increase or imbalance in ROS alters the intracellular redox homeostasis, triggers DNA damage, and may contribute to cancer development and progression.  This entry contains the mitochondrial protein, reactive oxygen species modulator 1 (Romo1), that is responsible for increasing the level of ROS in cells. In various cancer cell lines with elevated levels of ROS there is also an increased abundance of Romo1 []. Increased Romo1 expression can have a number of other affects including: inducing premature senescence of cultured human fibroblasts [, ] and increased resistance to 5-fluorouracil [].
Probab=26.64  E-value=46  Score=26.01  Aligned_cols=52  Identities=15%  Similarity=0.126  Sum_probs=30.4

Q ss_pred             hhhhhhHhhHHHHHHHHHHHHHHhcCcCCCCCCCCCCchhhhhHHHHHhhcchhhH
Q 022437          185 FAVGTSASLVGVGITNALINARKALDTSFAGEAEDVPIISTSVAYGVYMAVSSNLR  240 (297)
Q Consensus       185 ~~VGf~aGlvG~glSN~L~a~RK~~dpsf~~~~~~pPil~tA~~wg~fMGvSSNlR  240 (297)
                      ++||.+.|++-..    ....|....+..--.....-++.++.++|.||++=+=+|
T Consensus        15 ~~VG~~~G~l~G~----~~~~r~g~~~~~~~~~lg~~~l~sg~tFG~Fm~iGs~IR   66 (67)
T PF10247_consen   15 GAVGGAFGALFGT----FSAFRYGARGRGLMRTLGKYMLGSGATFGFFMSIGSVIR   66 (67)
T ss_pred             hHHHhhhhhhhhh----HHHhccCCCCcchHhHHhHHHhcchhHHHHHHhhhcccc
Confidence            4455555555444    345555554432111233456778899999999877655


No 18 
>PHA00370 III attachment protein
Probab=26.17  E-value=1.2e+02  Score=29.73  Aligned_cols=26  Identities=19%  Similarity=-0.072  Sum_probs=11.3

Q ss_pred             CCCCCHHHHHHHHHHhccccCCchHH
Q 022437           88 AGFHNCTEAIFALAKAGRTLGDLPKD  113 (297)
Q Consensus        88 ~~~~~r~ei~~Vl~e~gr~~~sLP~D  113 (297)
                      .+++|-..+.-..+.+-..-.+.-++
T Consensus       143 s~d~d~~kma~a~kdaltE~~d~~~~  168 (297)
T PHA00370        143 AGDFDYPKMANANKDALTEDNDQNAL  168 (297)
T ss_pred             ccccccHHHhhhhhhhhccccccchh
Confidence            34555555544444433333333333


No 19 
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification]
Probab=25.59  E-value=28  Score=35.77  Aligned_cols=11  Identities=27%  Similarity=0.199  Sum_probs=6.9

Q ss_pred             HHHHHHHHcCC
Q 022437          112 KDLAGAIEAGR  122 (297)
Q Consensus       112 ~Dl~~A~e~G~  122 (297)
                      +|+.+|++.++
T Consensus        46 adl~eal~~fG   56 (494)
T KOG1456|consen   46 ADLVEALSNFG   56 (494)
T ss_pred             hHHHHHHhcCC
Confidence            56777766554


No 20 
>PHA00370 III attachment protein
Probab=25.12  E-value=64  Score=31.55  Aligned_cols=7  Identities=29%  Similarity=0.866  Sum_probs=4.7

Q ss_pred             HHHHhhh
Q 022437          241 YQVLAGV  247 (297)
Q Consensus       241 YQiL~Gl  247 (297)
                      ||+..+-
T Consensus       256 Ye~~I~C  262 (297)
T PHA00370        256 YEFIIGC  262 (297)
T ss_pred             hhhhhcc
Confidence            6777665


No 21 
>TIGR02877 spore_yhbH sporulation protein YhbH. This protein family, typified by YhbH in Bacillus subtilis, is found in nearly every endospore-forming bacterium and in no other genome (but note that the trusted cutoff score is set high to exclude a single high-scoring sequence from Nitrosococcus oceani ATCC 19707, which is classified in the Gammaproteobacteria). The gene in Bacillus subtilis was shown to be in the regulon of the sporulation sigma factor, sigma-E, and its mutation was shown to create a sporulation defect.
Probab=24.64  E-value=85  Score=31.77  Aligned_cols=11  Identities=18%  Similarity=0.005  Sum_probs=6.5

Q ss_pred             CHHHHHHHHHH
Q 022437           92 NCTEAIFALAK  102 (297)
Q Consensus        92 ~r~ei~~Vl~e  102 (297)
                      .++|+..+|=|
T Consensus       115 s~eE~~~~lfE  125 (371)
T TIGR02877       115 TLEELFELLFE  125 (371)
T ss_pred             cHHHHHHHHHh
Confidence            46666666544


No 22 
>PF12095 DUF3571:  Protein of unknown function (DUF3571);  InterPro: IPR021954  This family of proteins is functionally uncharacterised. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 85 to 97 amino acids in length. ; PDB: 2KRX_A.
Probab=24.44  E-value=75  Score=25.87  Aligned_cols=27  Identities=30%  Similarity=0.212  Sum_probs=21.7

Q ss_pred             CCHHHHHHHHHHhccccCCchHHHHHH
Q 022437           91 HNCTEAIFALAKAGRTLGDLPKDLAGA  117 (297)
Q Consensus        91 ~~r~ei~~Vl~e~gr~~~sLP~Dl~~A  117 (297)
                      -..+|..+-|++|-.+.++||.|+++-
T Consensus        24 lt~~Ell~~Lk~~L~~~~~LP~dL~~~   50 (83)
T PF12095_consen   24 LTPEELLEKLKEWLQNQDDLPPDLAKF   50 (83)
T ss_dssp             E-HHHHHHHHHHHHHHTTTS-HHHHH-
T ss_pred             CCHHHHHHHHHHHHHcCCCCCHHHHhC
Confidence            356899999999999999999999853


No 23 
>PF10415 FumaraseC_C:  Fumarase C C-terminus;  InterPro: IPR018951  Fumarase C catalyses the stereo-specific interconversion of fumarate to L-malate as part of the Krebs cycle. The full-length protein forms a tetramer with visible globular shape. FumaraseC_C is the C-terminal 65 residues referred to as domain 3. The core of the molecule consists of a bundle of 20 alpha-helices from the five-helix bundle of domain 2. The projections from the core of the tetramer are generated from domains 1 and 3 of each subunit []. This entry does not appear to be part of either the active site or the activation site but is helical in structure forming a little bundle. ; GO: 0016829 lyase activity, 0006099 tricarboxylic acid cycle; PDB: 3RRP_A 3OCE_D 3OCF_D 3E04_B 3GTD_A 3R6V_F 3R6Q_F 1J3U_B 1FUR_A 1YFE_A ....
Probab=23.04  E-value=1.1e+02  Score=22.47  Aligned_cols=39  Identities=15%  Similarity=0.088  Sum_probs=28.1

Q ss_pred             HHHHHHHHHhccccCCchHHHHHHHHcCCCCHHHHHHHHhcc
Q 022437           94 TEAIFALAKAGRTLGDLPKDLAGAIEAGRVPAAIVKRYLELE  135 (297)
Q Consensus        94 ~ei~~Vl~e~gr~~~sLP~Dl~~A~e~G~Vs~~~L~rfl~l~  135 (297)
                      +.+.++-+++.++..++..-   +++.|.++.+++.+.|+.+
T Consensus        12 e~aa~iAk~A~~~g~svre~---v~~~g~lt~ee~d~ll~p~   50 (55)
T PF10415_consen   12 EKAAEIAKEALAEGRSVREV---VLEEGLLTEEELDELLDPE   50 (55)
T ss_dssp             HHHHHHHHHHHHHT--HHHH---HHHTTSS-HHHHHHHTSHH
T ss_pred             HHHHHHHHHHHHcCCCHHHH---HHHcCCCCHHHHHHHcCHH
Confidence            45667788888888887643   4588999999999999865


No 24 
>COG3028 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.95  E-value=1.1e+02  Score=28.42  Aligned_cols=28  Identities=25%  Similarity=0.478  Sum_probs=21.1

Q ss_pred             hHhhhhccchhhhhccc-----hhhhhhccCCC
Q 022437          140 FRWLLNFGGFRERLLAD-----DLFLVAFTGTS  167 (297)
Q Consensus       140 ~~~l~rf~gfR~RlLAD-----P~FL~a~pg~~  167 (297)
                      ...|++---+|+||+||     +.||-.+|-.+
T Consensus       113 ~a~lHklE~~RdrLia~GD~Alt~~l~~~P~aD  145 (187)
T COG3028         113 VALLHKLEQLRDRLIAEGDGALTEFLNQYPDAD  145 (187)
T ss_pred             HHHHHHHHHHHHHHHhcCchHHHHHHHHCCccc
Confidence            34566678899999999     66777777544


No 25 
>cd00086 homeodomain Homeodomain;  DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner.
Probab=21.78  E-value=2.2e+02  Score=19.34  Aligned_cols=42  Identities=12%  Similarity=-0.012  Sum_probs=31.3

Q ss_pred             HHHHHHHHHHhccccCCch-HHHHHHHHcCCCCHHHHHHHHhc
Q 022437           93 CTEAIFALAKAGRTLGDLP-KDLAGAIEAGRVPAAIVKRYLEL  134 (297)
Q Consensus        93 r~ei~~Vl~e~gr~~~sLP-~Dl~~A~e~G~Vs~~~L~rfl~l  134 (297)
                      -++...+|.+|+..-.... .++.+-++.-.++..++..||.-
T Consensus         8 ~~~~~~~Le~~f~~~~~P~~~~~~~la~~~~l~~~qV~~WF~n   50 (59)
T cd00086           8 TPEQLEELEKEFEKNPYPSREEREELAKELGLTERQVKIWFQN   50 (59)
T ss_pred             CHHHHHHHHHHHHhCCCCCHHHHHHHHHHHCcCHHHHHHHHHH
Confidence            3566788999998855433 56777777777999999998863


No 26 
>PF12244 DUF3606:  Protein of unknown function (DUF3606);  InterPro: IPR022037  This family of proteins is found in bacteria. Proteins in this family are typically between 58 and 85 amino acids in length. There is a single completely conserved residue G that may be functionally important. 
Probab=21.21  E-value=1.5e+02  Score=21.96  Aligned_cols=36  Identities=22%  Similarity=0.297  Sum_probs=30.1

Q ss_pred             HHHHHhccccCCchHHHHHHHHcCCCCHHHHHHHHh
Q 022437           98 FALAKAGRTLGDLPKDLAGAIEAGRVPAAIVKRYLE  133 (297)
Q Consensus        98 ~Vl~e~gr~~~sLP~Dl~~A~e~G~Vs~~~L~rfl~  133 (297)
                      .-++-|.+++.-=++.|++|++.-+-+.+.+.+||.
T Consensus        21 ~ev~ywa~~~gvt~~~L~~AV~~vG~~~~~V~~~L~   56 (57)
T PF12244_consen   21 YEVRYWAKRFGVTEEQLREAVRAVGNSRAAVRAYLG   56 (57)
T ss_pred             HHHHHHHHHHCcCHHHHHHHHHHHCcCHHHHHHHHc
Confidence            345677777777789999999999999999999874


No 27 
>PF08535 KorB:  KorB domain;  InterPro: IPR013741 This entry contains several KorB transcriptional repressor proteins. The korB gene is a major regulatory element in the replication and maintenance of broad host-range plasmid RK2. It negatively controls the replication gene trfA, the host-lethal determinants kilA and kilB, and the korA-korB operon []. This domain includes the DNA-binding HTH motif []. ; PDB: 1R71_C.
Probab=20.77  E-value=69  Score=25.10  Aligned_cols=22  Identities=27%  Similarity=0.557  Sum_probs=14.2

Q ss_pred             ccCCchHHHHHHHHcCCCCHHH
Q 022437          106 TLGDLPKDLAGAIEAGRVPAAI  127 (297)
Q Consensus       106 ~~~sLP~Dl~~A~e~G~Vs~~~  127 (297)
                      ++.+||.+++++++.|.|+...
T Consensus        25 ~Ll~lP~~i~~~v~~g~~~~~~   46 (93)
T PF08535_consen   25 ALLDLPEEIKELVRSGRISDIR   46 (93)
T ss_dssp             GGGS--HHHHHHHHTTS---HH
T ss_pred             HHHcCCHHHHHHHHcCCCchHH
Confidence            3668999999999999997543


Done!