Citrus Sinensis ID: 022500


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290------
MRVMDHPNVISLKHCFFSTTSKNELFLNLVMEYVPESMYRVLKHYSSANQRMPLIYVKLYTYQIFRGLAYIHTVPRVCHRDLKPQNLLVDPLTHQVKICDFGSAKQLIAGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPLPPLFNFKQELSGASPELVNKLIPDHVKRQLGLNFLHPAGT
ccccccccEEEEcEEEccccccccEEEEEEEcccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEcccccccccccccccEEEEEcccccHHHHHccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHccccccccccHHHHHcccccccccccccccccccccccccccccccccccHHHHHHccHHHHHHHccccccccccc
MRVMDHPNVISLKHCFFSTTSKNELFLNLVMEYVPESMYRVLKHYSSANQRMPLIYVKLYTYQIFRGLAYIHTVPRVCHRDLKPQNLLVDPLTHQVKICDFGSAKQLIAGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPLPPLFNFKQELSGASPELVNKLIPDHVKRQLGL********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRVMDHPNVISLKHCFFSTTSKNELFLNLVMEYVPESMYRVLKHYSSANQRMPLIYVKLYTYQIFRGLAYIHTVPRVCHRDLKPQNLLVDPLTHQVKICDFGSAKQLIAGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPLPPLFNFKQELSGASPELVNKLIPDHVKRQLGLNFLHPAGT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Shaggy-related protein kinase eta Negative regulator in brassinosteroid signal transduction pathway important for plant growth. May be also involved in auxin signaling pathway. Phosphorylates and increases the degradation of BZR1 and BZR2/BES1 by the proteasome. Phosphorylates BHLH150, beet curly top virus C4 and tomato golden mosaic virus AC4 on threonine and serine residues.confidentQ39011
Shaggy-related protein kinase NtK-1 May mediate extracellular signals to regulate transcription in differentiating cells.probableQ40518
Glycogen synthase kinase-3 beta Constitutively active protein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transcription factors and microtubules, by phosphorylating and inactivating glycogen synthase (GYS1 or GYS2), EIF2B, CTNNB1/beta-catenin, APC, AXIN1, DPYSL2/CRMP2, JUN, NFATC1/NFATC, MAPT/TAU and MACF1. Requires primed phosphorylation of the majority of its substrates. In skeletal muscle, contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. May also mediate the development of insulin resistance by regulating activation of transcription factors. Regulates protein synthesis by controlling the activity of initiation factor 2B (EIF2BE/EIF2B5) in the same manner as glycogen synthase. In Wnt signaling, GSK3B forms a multimeric complex with APC, AXIN1 and CTNNB1/beta-catenin and phosphorylates the N-terminus of CTNNB1 leading to its degradation mediated by ubiquitin/proteasomes. Phosphorylates JUN at sites proximal to its DNA-binding domain, thereby reducing its affinity for DNA. Phosphorylates NFATC1/NFATC on conserved serine residues promoting NFATC1/NFATC nuclear export, shutting off NFATC1/NFATC gene regulation, and thereby opposing the action of calcineurin. Phosphorylates MAPT/TAU on 'Thr-548', decreasing significantly MAPT/TAU ability to bind and stabilize microtubules. Plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. Phosphorylates MACF1, inhibiting its binding to microtubules which is critical for its role in bulge stem cell migration and skin wound repair. Probably regulates NF-kappa-B (NFKB1) at the transcriptional level and is required for the NF-kappa-B-mediated anti-apoptotic response to TNF-alpha (TNF/TNFA). Negatively regulates replication in pancreatic beta-cells, resulting in apoptosis, loss of beta-cells. Phosphorylates MUC1 in breast cancer cells, decreasing the interaction of MUC1 with CTNNB1/beta-catenin. Is necessary for the establishment of neuronal polarity and axon outgrowth. Phosphorylates MARK2, leading to inhibit its activity. Phosphorylates SIK1 at 'Thr-182', leading to sustain its activity.probableQ9WV60

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4E7W, chain A
Confidence level:very confident
Coverage over the Query: 1-285
View the alignment between query and template
View the model in PyMOL