Citrus Sinensis ID: 022510

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290------
MGLCWGLPKEKFTVPQRFFCHFYVVAVVWTTLLLFTLWAYAYKMAPSVSEPSLYSTIASHLTGGSHMFSFHKSHLTLLQHRHRVWSSVFVLLLMEIQVVRRLIETIYTFQYSPSARMHIFGYLTGLFFYTAAPLSLCCTLAPEVFGFAAALVAEFIVKGKRQMPAFEFELWESVNPFLKLRWFQWIGAAIFLWGWMHQRCCHAILGSLRERAEQIDEYVIPHGDWFEIVSCPHYLAEIVIYAGLLVASGGTDITIWLLFAFVVVNLVFAAAETQRWYIRKFDNYPSNRYAIIPYVY
ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccECcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEccccc
****WGLPKEKFTVPQRFFCHFYVVAVVWTTLLLFTLWAYAYKMAPSVSEPSLYSTIASHLTGGSHMFSFHKSHLTLLQHRHRVWSSVFVLLLMEIQVVRRLIETIYTFQYSPSARMHIFGYLTGLFFYTAAPLSLCCTLAPEVFGFAAALVAEFIVKGKRQMPAFEFELWESVNPFLKLRWFQWIGAAIFLWGWMHQRCCHAILGSLRERAEQIDEYVIPHGDWFEIVSCPHYLAEIVIYAGLLVASGGTDITIWLLFAFVVVNLVFAAAETQRWYIRKFDNYPSNRYAIIPYVY
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLCWGLPKEKFTVPQRFFCHFYVVAVVWTTLLLFTLWAYAYKMAPSVSEPSLYSTIASHLTGGSHMFSFHKSHLTLLQHRHRVWSSVFVLLLMEIQVVRRLIETIYTFQYSPSARMHIFGYLTGLFFYTAAPLSLCCTLAPEVFGFAAALVAEFIVKGKRQMPAFEFELWESVNPFLKLRWFQWIGAAIFLWGWMHQRCCHAILGSLRERAEQIDEYVIPHGDWFEIVSCPHYLAEIVIYAGLLVASGGTDITIWLLFAFVVVNLVFAAAETQRWYIRKFDNYPSNRYAIIPYVY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polyprenol reductase 2 Probable polyprenol reductase. Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Probably acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism.probableQ9SI62
Polyprenol reductase 1 Probable polyprenol reductase. Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Probably acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism.probableQ7XUH5

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A2N, chain B
Confidence level:confident
Coverage over the Query: 181-294
View the alignment between query and template
View the model in PyMOL