Citrus Sinensis ID: 022587

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-----
MATDLQMSPQLEQIHGEIRDNFRALSNGFQKLDKIKDSNRQTKQLEELTGRMRECKRLIKEMDREIKDEEARNPPEVNKQLNDEKQSMIKELNSYVALRKTYMNSLGNKKVELFDMGAGVSEPTADENVQVASSMSNQELIDAGKKTMDETDQAIKRSQMVVEQTIEVGTQTATTLKGQTDQMGRIVNELDTIQFSIKKASQLVKEIGRQVATDKCIMLFLFLIVCGVIAIIVVKVLTHIKSQHNFQQWQFSIFCLLSMNFQVVNPNNKDIRDIPGLAPPAPARRLLSLQAPEHF
ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHcccccccEEEccccccccccccccccccccccccccccccc
************QIHGEIRDNFRAL******************************************************************LNSYVALRKTYMNSLGNKKVELFD*************************************************TIEVGTQTATTLKGQTDQMGRIVNELDTIQFSIKKASQLVKEIGRQVATDKCIMLFLFLIVCGVIAIIVVKVLTHIKSQHNFQQWQFSIFCLLSMNFQVVNPNNKDIRDIPGLAPPAPAR***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATDLQMSPQLEQIHGEIRDNFRALSNGFQKLDKIKDSNRQTKQxxxxxxxxxxxxxxxxxxxxxxxxxxxxNPPEVxxxxxxxxxxxxxxxxxxxxxRKTYMNSLGNKKVELFDMGAGVSEPTADENVQVASSMSNQELIDAGKKTMDETDQAIKRSQMVVEQTIEVGTQTATTLKGQTDQMGRIVNELDTIQFSIKKASQLVKEIGRQVATDKCIMLFLFLIVCGVIAIIVVKVLTHIKSQHNFQQWQFSIFCLLSMNFQVVNPNNKDIRDIPGLAPPAPARRLLSLQAPEHF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Novel plant SNARE 13 Vesicle trafficking protein that functions in the secretory pathway.confidentQ9LRP1
Novel plant SNARE 12 Vesicle trafficking protein that functions in the secretory pathway.probableQ9LNH6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NPS, chain C
Confidence level:confident
Coverage over the Query: 136-213
View the alignment between query and template
View the model in PyMOL
Template: 2QYW, chain A
Confidence level:confident
Coverage over the Query: 2-102
View the alignment between query and template
View the model in PyMOL