Query         022591
Match_columns 294
No_of_seqs    143 out of 303
Neff          3.2 
Searched_HMMs 46136
Date          Fri Mar 29 04:43:16 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/022591.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/022591hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03195 DUF260:  Protein of un 100.0 1.8E-45   4E-50  297.4   8.4  101    4-109     1-101 (101)
  2 PF04706 Dickkopf_N:  Dickkopf   16.0      79  0.0017   23.5   1.1   16    3-18     21-36  (52)
  3 PF14653 IGFL:  Insulin growth   15.9      76  0.0016   26.3   1.0   15   12-26     42-56  (89)
  4 PF03242 LEA_3:  Late embryogen  14.3      75  0.0016   26.2   0.6   20   70-89     58-77  (93)
  5 PRK00451 glycine dehydrogenase  13.6   1E+02  0.0022   29.6   1.4   35   22-62      2-36  (447)
  6 PF15300 INT_SG_DDX_CT_C:  INTS  11.6 1.1E+02  0.0024   23.8   0.8   30   45-74     18-51  (65)
  7 PF00172 Zn_clus:  Fungal Zn(2)  11.5 1.2E+02  0.0025   20.5   0.8   15    3-17      1-15  (40)
  8 PF05965 FYRC:  F/Y rich C-term  10.7 1.7E+02  0.0036   22.5   1.6   22   41-62     53-76  (86)
  9 PF14623 Vint:  Hint-domain      10.3 1.1E+02  0.0024   27.6   0.5   38   41-84    122-159 (162)
 10 smart00542 FYRC "FY-rich" doma   7.9 2.5E+02  0.0053   22.1   1.5   20   42-61     50-71  (86)

No 1  
>PF03195 DUF260:  Protein of unknown function DUF260;  InterPro: IPR004883 The lateral organ boundaries (LOB) gene is expressed at the adaxial base of initiating lateral organs and encodes a plant-specific protein of unknown function. The N-terminal one half of the LOB protein contains a conserved approximately 100-amino acid domain (the LOB domain) that is present in 42 other Arabidopsis thaliana proteins and in proteins from a variety of other plant species. Genes encoding LOB domain (LBD) proteins are expressed in a variety of temporal- and tissue-specific patterns, suggesting that they may function in diverse processes [] The LOB domain contains conserved blocks of amino acids that identify the LBD gene family. In particular, a conserved C-x(2)-C-x(6)-C-x(3)-C motif, which is defining feature of the LOB domain, is present in all LBD proteins. It is possible that this motif forms a new zinc finger [].
Probab=100.00  E-value=1.8e-45  Score=297.44  Aligned_cols=101  Identities=30%  Similarity=0.576  Sum_probs=97.4

Q ss_pred             CChhhhhccCCCCCCCccccCCCCCCCChhhhhhHHHHHhhcccccHHHHHhcCCCCChHHHHHHhhhhhcccccCCCcc
Q 022591            4 SCNGCRVLRKGCNENCSIRPCLQWIKSPESQANATVFLAKFYGRAGLMNLINAGPEHLRPAVFRSLLYEACGRIVNPIYG   83 (294)
Q Consensus         4 ~CAACK~LRRkC~~dCilAPYFPw~~spe~q~naf~fvhKVFG~SNV~KmL~~lp~~~R~dA~~SL~YEA~aR~rDPVyG   83 (294)
                      +|||||||||+|+++|+||||||     .++.+.|.++|||||++||+|||+++|+++|+++|+||+|||++|.+|||||
T Consensus         1 ~CaaCk~lRr~C~~~C~laPyFP-----~~~~~~F~~vhkvFG~sni~k~L~~~~~~~R~~a~~Sl~yEA~~R~~dPv~G   75 (101)
T PF03195_consen    1 PCAACKHLRRRCSPDCVLAPYFP-----ADQPQRFANVHKVFGVSNISKMLQELPPEQREDAMRSLVYEANARARDPVYG   75 (101)
T ss_pred             CChHHHHHhCCCCCCCcCCCCCC-----hhHHHHHHHHHHHHchhHHHHHHHhCCccchhhHHHHHHHHHHhhccCCCcc
Confidence            79999999999999999999998     5667889999999999999999999999999999999999999999999999


Q ss_pred             chhhhhhhhHHHHHHHHHHHHcCCCc
Q 022591           84 SVGLLWSGSWQLCQAAVEAVLKGAPI  109 (294)
Q Consensus        84 cvGiI~~Lq~Qi~qaavEavL~ga~I  109 (294)
                      |+|+||.|||||+++++|+++.+++|
T Consensus        76 c~G~i~~L~~ql~~~~~el~~~~~~l  101 (101)
T PF03195_consen   76 CVGIISQLQQQLQQLQAELALVRAQL  101 (101)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHccC
Confidence            99999999999999999999998876


No 2  
>PF04706 Dickkopf_N:  Dickkopf N-terminal cysteine-rich region;  InterPro: IPR006796 Dickkopf proteins are a class of Wnt antagonists. They possess two conserved cysteine-rich regions. This family represents the N-terminal conserved region []. The C-terminal region has been found to share significant sequence similarity to the colipase fold (IPR001981 from INTERPRO) [].; GO: 0007275 multicellular organismal development, 0030178 negative regulation of Wnt receptor signaling pathway, 0005576 extracellular region
Probab=15.97  E-value=79  Score=23.49  Aligned_cols=16  Identities=38%  Similarity=0.821  Sum_probs=14.1

Q ss_pred             CCChhhhhccCCCCCC
Q 022591            3 MSCNGCRVLRKGCNEN   18 (294)
Q Consensus         3 ~~CAACK~LRRkC~~d   18 (294)
                      ..|..||-+|++|..|
T Consensus        21 ~~C~~Cr~~~~rC~Rd   36 (52)
T PF04706_consen   21 SKCLPCRKRRKRCTRD   36 (52)
T ss_pred             ccChhhccCCCCCCCC
Confidence            4699999999999966


No 3  
>PF14653 IGFL:  Insulin growth factor-like family
Probab=15.91  E-value=76  Score=26.27  Aligned_cols=15  Identities=33%  Similarity=1.150  Sum_probs=13.3

Q ss_pred             cCCCCCCCccccCCC
Q 022591           12 RKGCNENCSIRPCLQ   26 (294)
Q Consensus        12 RRkC~~dCilAPYFP   26 (294)
                      -++|..+|.|.|+|.
T Consensus        42 T~~Cg~~Ctf~pcfe   56 (89)
T PF14653_consen   42 TRKCGPNCTFWPCFE   56 (89)
T ss_pred             ccccCCCCCccCccc
Confidence            378999999999996


No 4  
>PF03242 LEA_3:  Late embryogenesis abundant protein;  InterPro: IPR004926  Late-embryogenesis abundant (LEA) genes encode a diverse group of proteins that accumulate to high levels during the maturation phase of seed development [].  This group includes LEA-5 [], whose expression is induced by salt, drought and heat stress [], and related proteins. ; GO: 0006950 response to stress
Probab=14.27  E-value=75  Score=26.15  Aligned_cols=20  Identities=15%  Similarity=0.061  Sum_probs=16.3

Q ss_pred             hhhhcccccCCCccchhhhh
Q 022591           70 LYEACGRIVNPIYGSVGLLW   89 (294)
Q Consensus        70 ~YEA~aR~rDPVyGcvGiI~   89 (294)
                      -++-..|..|||-|++--..
T Consensus        58 ~~~~~~W~pDPvTGyyrPen   77 (93)
T PF03242_consen   58 SKEKSSWMPDPVTGYYRPEN   77 (93)
T ss_pred             cccccccccCCCCccccCCC
Confidence            66778999999999986544


No 5  
>PRK00451 glycine dehydrogenase subunit 1; Validated
Probab=13.58  E-value=1e+02  Score=29.64  Aligned_cols=35  Identities=23%  Similarity=0.292  Sum_probs=23.6

Q ss_pred             ccCCCCCCCChhhhhhHHHHHhhcccccHHHHHhcCCCCCh
Q 022591           22 RPCLQWIKSPESQANATVFLAKFYGRAGLMNLINAGPEHLR   62 (294)
Q Consensus        22 APYFPw~~spe~q~naf~fvhKVFG~SNV~KmL~~lp~~~R   62 (294)
                      -||.|  .+++++    ..+-+.||.++|-.++..+|.+.|
T Consensus         2 ~~~~~--~~~~~~----~~~~~~~~~~~~~~~~~~~p~~~~   36 (447)
T PRK00451          2 MPYIP--HTEEDI----REMLDAIGVKSIDELFADIPEELR   36 (447)
T ss_pred             CCCCC--CCHHHH----HHHHHHhCCCCHHHHHHhCCHHHH
Confidence            38888  344443    246789999999888776765444


No 6  
>PF15300 INT_SG_DDX_CT_C:  INTS6/SAGE1/DDX26B/CT45 C-terminus
Probab=11.61  E-value=1.1e+02  Score=23.81  Aligned_cols=30  Identities=23%  Similarity=0.408  Sum_probs=24.9

Q ss_pred             ccc--ccHHHHHhcC--CCCChHHHHHHhhhhhc
Q 022591           45 YGR--AGLMNLINAG--PEHLRPAVFRSLLYEAC   74 (294)
Q Consensus        45 FG~--SNV~KmL~~l--p~~~R~dA~~SL~YEA~   74 (294)
                      +|.  +.|.++|+.+  |.+.|...+..++.||.
T Consensus        18 pGr~ye~iF~lL~~vqG~~~~r~~fv~~~IkEA~   51 (65)
T PF15300_consen   18 PGRNYEKIFKLLEQVQGPLEVRKQFVEMIIKEAA   51 (65)
T ss_pred             cCCcHHHHHHHHHHccCCHHHHHHHHHHHHHHHH
Confidence            555  4788999975  78899999999999985


No 7  
>PF00172 Zn_clus:  Fungal Zn(2)-Cys(6) binuclear cluster domain;  InterPro: IPR001138 The N-terminal region of a number of fungal transcriptional regulatory proteins contains a Cys-rich motif that is involved in zinc-dependent binding of DNA. The region forms a binuclear Zn cluster, in which two Zn atoms are bound by six Cys residues [, ]. A wide range of proteins are known to contain this domain. These include the proteins involved in arginine, proline, pyrimidine, quinate, maltose and galactose metabolism; amide and GABA catabolism; leucine biosynthesis, amongst others.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1AJY_A 1ZME_C 2VEQ_A 1CLD_A 1PYI_B 1D66_A 3COQ_A 1AW6_A 2ER8_A 2ERE_A ....
Probab=11.50  E-value=1.2e+02  Score=20.50  Aligned_cols=15  Identities=27%  Similarity=0.820  Sum_probs=10.7

Q ss_pred             CCChhhhhccCCCCC
Q 022591            3 MSCNGCRVLRKGCNE   17 (294)
Q Consensus         3 ~~CAACK~LRRkC~~   17 (294)
                      .+|..|+..+.+|..
T Consensus         1 ~aC~~Cr~rK~kCd~   15 (40)
T PF00172_consen    1 RACDRCRRRKVKCDG   15 (40)
T ss_dssp             -SBHHHHHHTS--ST
T ss_pred             CcChHHHhhCcCcCC
Confidence            379999999999986


No 8  
>PF05965 FYRC:  F/Y rich C-terminus;  InterPro: IPR003889 The "FY-rich" domain C-terminal region is sometimes closely juxtaposed with the N-terminal region (IPR003888 from INTERPRO), but sometimes is far distant. It is of unknown function, but occurs frequently in chromatin-associated proteins like trithorax and its homologues.; GO: 0005634 nucleus; PDB: 2WZO_A.
Probab=10.74  E-value=1.7e+02  Score=22.54  Aligned_cols=22  Identities=18%  Similarity=0.321  Sum_probs=17.8

Q ss_pred             HHhhccccc--HHHHHhcCCCCCh
Q 022591           41 LAKFYGRAG--LMNLINAGPEHLR   62 (294)
Q Consensus        41 vhKVFG~SN--V~KmL~~lp~~~R   62 (294)
                      -+.+||.++  |.++|++||-.++
T Consensus        53 G~~~FGls~p~V~~lie~Lp~a~~   76 (86)
T PF05965_consen   53 GPEMFGLSNPAVQRLIESLPGADK   76 (86)
T ss_dssp             HHHHHSTTSHHHHHHHTTSTTGGG
T ss_pred             HhHhcCCCCHHHHHHHHhCCCcch
Confidence            478999865  8999999997554


No 9  
>PF14623 Vint:  Hint-domain
Probab=10.27  E-value=1.1e+02  Score=27.57  Aligned_cols=38  Identities=18%  Similarity=0.259  Sum_probs=28.8

Q ss_pred             HHhhcccccHHHHHhcCCCCChHHHHHHhhhhhcccccCCCccc
Q 022591           41 LAKFYGRAGLMNLINAGPEHLRPAVFRSLLYEACGRIVNPIYGS   84 (294)
Q Consensus        41 vhKVFG~SNV~KmL~~lp~~~R~dA~~SL~YEA~aR~rDPVyGc   84 (294)
                      +|.|||-..|.+-|..|+.-.-      =+.+...-.|||.-|-
T Consensus       122 aH~fFG~~~V~~~L~~L~~~~~------G~v~~~g~~Rd~~Tgl  159 (162)
T PF14623_consen  122 AHAFFGDNAVVRDLASLPGFAN------GVVECRGVKRDPETGL  159 (162)
T ss_pred             eecccCcHHHHHHHHhCCCCCC------CEEEecceEECccccc
Confidence            6999999999999999986422      2455666688887764


No 10 
>smart00542 FYRC "FY-rich" domain, C-terminal region. is sometimes closely juxtaposed with the N-terminal region (FYRN), but sometimes is far distant. Unknown function, but occurs frequently in chromatin-associated proteins.
Probab=7.90  E-value=2.5e+02  Score=22.12  Aligned_cols=20  Identities=20%  Similarity=0.409  Sum_probs=16.3

Q ss_pred             Hhhccccc--HHHHHhcCCCCC
Q 022591           42 AKFYGRAG--LMNLINAGPEHL   61 (294)
Q Consensus        42 hKVFG~SN--V~KmL~~lp~~~   61 (294)
                      ..+||.++  |+++|++||..+
T Consensus        50 ~~mFGls~p~V~~lie~Lpga~   71 (86)
T smart00542       50 EDMFGLSSPAVVKLIEQLPGVH   71 (86)
T ss_pred             HHHhCCCcHHHHHHHHhCCCch
Confidence            47899876  899999999754


Done!