Query         022600
Match_columns 294
No_of_seqs    15 out of 17
Neff          2.0 
Searched_HMMs 46136
Date          Fri Mar 29 04:47:08 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/022600.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/022600hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF07803 GSG-1:  GSG1-like prot  65.5      19 0.00042   30.8   5.8   69   31-107     5-74  (118)
  2 PF06930 DUF1282:  Protein of u  54.9      14  0.0003   30.8   3.2   18   14-31      5-22  (170)
  3 PF05478 Prominin:  Prominin;    50.5     7.8 0.00017   40.2   1.2   81  100-188   407-489 (806)
  4 PF03884 DUF329:  Domain of unk  42.7     9.4  0.0002   28.7   0.3   14   61-75     16-29  (57)
  5 TIGR00353 nrfE c-type cytochro  41.9      86  0.0019   32.3   7.0   73  103-213   112-206 (576)
  6 PRK00418 DNA gyrase inhibitor;  39.4      13 0.00028   28.6   0.6   14   61-75     20-33  (62)
  7 PRK05529 cell division protein  39.1      42 0.00091   30.4   3.9   45    4-49      7-51  (255)
  8 PRK01343 zinc-binding protein;  38.2      14 0.00031   28.0   0.7   14   63-77     21-34  (57)
  9 COG4993 Gcd Glucose dehydrogen  37.6      21 0.00045   38.3   1.9   49  165-221     7-55  (773)
 10 PF04893 Yip1:  Yip1 domain;  I  36.6      39 0.00085   26.2   2.9   38   13-50      4-41  (172)
 11 PF06103 DUF948:  Bacterial pro  33.3      38 0.00083   25.6   2.3   23  164-186     3-25  (90)
 12 PF04156 IncA:  IncA protein;    32.3      40 0.00086   28.2   2.5   62  158-221     2-66  (191)
 13 PF12911 OppC_N:  N-terminal TM  32.1      67  0.0015   22.0   3.2   29   26-54      7-36  (56)
 14 PF03900 Porphobil_deamC:  Porp  29.8      24 0.00051   26.1   0.7   14  180-193     9-22  (74)
 15 PF11998 DUF3493:  Protein of u  29.3   1E+02  0.0023   24.4   4.2   28   13-40      1-29  (75)
 16 KOG4681 Uncharacterized conser  28.4      36 0.00079   32.8   1.8   29  152-183    50-81  (280)
 17 COG3024 Uncharacterized protei  28.1      24 0.00051   27.7   0.5   18   59-77     19-36  (65)
 18 PF11239 DUF3040:  Protein of u  28.0      38 0.00082   25.8   1.5   15  199-213    67-81  (82)
 19 PF07423 DUF1510:  Protein of u  25.6      65  0.0014   29.6   2.8   20  161-180    14-33  (217)
 20 PF04156 IncA:  IncA protein;    25.3      66  0.0014   26.9   2.6   26  163-188    33-58  (191)
 21 KOG3879 Predicted membrane pro  25.2      66  0.0014   30.9   2.9   30   99-128    77-106 (267)
 22 KOG1176 Acyl-CoA synthetase [L  23.8      45 0.00097   33.8   1.6   29  189-217   230-259 (537)
 23 PF01284 MARVEL:  Membrane-asso  23.8      94   0.002   23.8   3.1   24  118-141    84-107 (144)
 24 PF07328 VirD1:  T-DNA border e  23.4      42 0.00091   29.8   1.2   20   13-32    100-119 (147)
 25 PF03522 KCl_Cotrans_1:  K-Cl C  23.1      39 0.00084   23.3   0.7   13  266-278    13-25  (30)
 26 KOG0347 RNA helicase [RNA proc  22.7      46 0.00099   35.6   1.5   46  222-270    35-81  (731)
 27 PF10945 DUF2629:  Protein of u  21.9      74  0.0016   23.3   2.0   31    6-36      7-39  (44)
 28 PF07708 Tash_PEST:  Tash prote  21.8      43 0.00093   21.0   0.7    8  266-273    12-19  (19)
 29 PF03739 YjgP_YjgQ:  Predicted   21.6      94   0.002   27.7   3.0   53  162-218   302-354 (354)
 30 TIGR03089 conserved hypothetic  21.4      60  0.0013   28.1   1.7   27  190-216   183-210 (227)
 31 PF03383 Serpentine_r_xa:  Caen  21.4      52  0.0011   28.8   1.4   18    6-23     24-41  (153)
 32 COG3230 HemO Heme oxygenase [I  21.1      34 0.00073   31.6   0.1   45  210-257   123-180 (196)
 33 COG0117 RibD Pyrimidine deamin  20.9      68  0.0015   28.3   2.0   44  217-261    98-145 (146)

No 1  
>PF07803 GSG-1:  GSG1-like protein;  InterPro: IPR012478 This family contains sequences bearing similarity to a region of GSG1 (Q9Z1H7 from SWISSPROT), a protein specifically expressed in testicular germ cells []. It is possible that over expression of the human homologue may be involved in tumourigenesis of human testicular germ cell tumours []. The region in question has four highly conserved cysteine residues. 
Probab=65.49  E-value=19  Score=30.85  Aligned_cols=69  Identities=19%  Similarity=0.379  Sum_probs=36.6

Q ss_pred             hchhHHHHHHHHHHHHHHHHhhheeEEEeecCCCCCCcccccc-cccccccccCCCCCCCCCCceeeeeccccceeeE
Q 022600           31 LQRPFLISALTLICIVVAVCTIVSLKIVFPSDYGRRPFCSDVR-LQPLQINVKGEGGDSDLFPGAFYLTDQETVDYYW  107 (294)
Q Consensus        31 LqrPl~~~~~~~v~~av~v~~~isl~iVFp~~~~~rpFC~~rR-L~~l~~~~~~~g~~~~~~pgAfylT~~Ea~dyyW  107 (294)
                      =||.++...+.+++++.-+.++.+-+--=-.-.--.|+|.+.+ ..=++......+ .+..       +++++|+|.|
T Consensus         5 ~~Ra~Ls~~ln~LAL~~S~tA~~sSyWC~GTqKVpKPlC~~~~~~~Ci~~~~~~~~-~~~~-------~~~~~VqY~W   74 (118)
T PF07803_consen    5 RQRALLSLILNLLALAFSTTALLSSYWCEGTQKVPKPLCGKGKGTNCIHFPSNSDS-GSNT-------SDSNVVQYIW   74 (118)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHhcccccccceecCCCCCCccccCcCcCCCCCCcc-cccC-------CCCceeEEEE
Confidence            3566776677777777666666665432211122358996533 222222211111 1211       3789999999


No 2  
>PF06930 DUF1282:  Protein of unknown function (DUF1282);  InterPro: IPR009698 This entry represents several hypothetical proteins of around 200 residues in length. The function of is unknown although a number of the members are thought to be putative membrane proteins.
Probab=54.86  E-value=14  Score=30.84  Aligned_cols=18  Identities=39%  Similarity=0.652  Sum_probs=16.1

Q ss_pred             ChhHHhhhhhhhhhhhhh
Q 022600           14 PKHEYERIREEDKAWVKL   31 (294)
Q Consensus        14 pk~~Ye~LReeekaw~kL   31 (294)
                      |.++||++|+|++.|..+
T Consensus         5 P~~~w~~i~~~~~~~~~~   22 (170)
T PF06930_consen    5 PSDEWERIKREHESSWAL   22 (170)
T ss_pred             hHHHHHHHHHcCCchhHH
Confidence            999999999999998644


No 3  
>PF05478 Prominin:  Prominin;  InterPro: IPR008795 The prominins are an emerging family of proteins that, among the multispan membrane proteins, display a novel topology. Mouse and Homo sapiens prominin and (Mus musculus) prominin-like 1 (PROML1) are predicted to contain five membrane spanning domains, with an N-terminal domain exposed to the extracellular space followed by four, alternating small cytoplasmic and large extracellular, loops and a cytoplasmic C-terminal domain []. The exact function of prominin is unknown although in humans defects in PROM1, the gene coding for prominin, cause retinal degeneration [].; GO: 0016021 integral to membrane
Probab=50.45  E-value=7.8  Score=40.20  Aligned_cols=81  Identities=20%  Similarity=0.449  Sum_probs=44.3

Q ss_pred             cccceeeEEeeehhhHHHHHHHHHHHhhceeeeeeC-C-CccceeEEeecccccccCCccchhhhHHHHHHHHHHHHHHH
Q 022600          100 QETVDYYWMVVFIPSTIIFLASIVYLVAGITVAYTA-P-RRHGCLNVVENNYCASKRGGVRCLSILNAVFAIIFGLLALF  177 (294)
Q Consensus       100 ~Ea~dyyWmVvF~Ps~v~f~~S~~YL~AGi~VAYsA-P-~RH~clkVVENn~CASkRGGVRCLsiLN~vFaiifgllAlf  177 (294)
                      ++-..|-|.+-.+=+.++.++ ++.++.|.....-- + +..|.     +.+|.|+-|| +|| ++-+.|+.+|..+-++
T Consensus       407 ~~y~~yR~~~~lil~~~llLI-v~~~~lGLl~G~~G~~~~~~p~-----~r~c~~~tGg-~~L-m~gv~~~Flf~~~l~l  478 (806)
T PF05478_consen  407 EKYDSYRWIVGLILCCVLLLI-VLCLLLGLLCGCCGYRRRADPT-----DRGCSSNTGG-NFL-MAGVGLSFLFSWFLML  478 (806)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHhhccCCCCCCCc-----ccCCCCCccH-HHH-HHHHHHHHHHHHHHHH
Confidence            334444555544444444444 44445666555444 2 22222     4577777776 576 3456676666666666


Q ss_pred             HhhhhhhcCCC
Q 022600          178 LGSSLLTLGSS  188 (294)
Q Consensus       178 LGsslLtLgss  188 (294)
                      ++.+.+.+|..
T Consensus       479 ~~~~~Fl~G~~  489 (806)
T PF05478_consen  479 LVLFYFLVGGN  489 (806)
T ss_pred             HHHHHHHHHhh
Confidence            66666666654


No 4  
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=42.70  E-value=9.4  Score=28.75  Aligned_cols=14  Identities=43%  Similarity=0.888  Sum_probs=8.5

Q ss_pred             cCCCCCCcccccccc
Q 022600           61 SDYGRRPFCSDVRLQ   75 (294)
Q Consensus        61 ~~~~~rpFC~~rRL~   75 (294)
                      .++.-||||++ |=+
T Consensus        16 ~~n~~rPFCS~-RCk   29 (57)
T PF03884_consen   16 PENPFRPFCSE-RCK   29 (57)
T ss_dssp             SSSS--SSSSH-HHH
T ss_pred             CCCCcCCcccH-hhc
Confidence            45578999998 533


No 5  
>TIGR00353 nrfE c-type cytochrome biogenesis protein CcmF. The product of this gene is required for the biogenesis of C-type cytochromes. This gene is thought to have eleven transmembrane helices. Disruption of this gene in Paracoccus denitrificans, encoding a putative transporter, results in formation of an unstable apocytochrome c and deficiency in siderophore production.
Probab=41.86  E-value=86  Score=32.35  Aligned_cols=73  Identities=27%  Similarity=0.448  Sum_probs=44.7

Q ss_pred             ceeeEEeeehhhHHH--------HHHHHHHHhhceeeeeeCCCccceeEEeecccccccCCccchhhhH--HHHHHHHHH
Q 022600          103 VDYYWMVVFIPSTII--------FLASIVYLVAGITVAYTAPRRHGCLNVVENNYCASKRGGVRCLSIL--NAVFAIIFG  172 (294)
Q Consensus       103 ~dyyWmVvF~Ps~v~--------f~~S~~YL~AGi~VAYsAP~RH~clkVVENn~CASkRGGVRCLsiL--N~vFaiifg  172 (294)
                      -+-+||.+=+|...+        |+.++.||+.|          |.               .-+...+.  -+.++.+|.
T Consensus       112 Lq~~~l~iH~p~~~lgya~~~v~f~~a~~~L~~~----------~~---------------~~~~~~~~~~~~~~g~~fl  166 (576)
T TIGR00353       112 LQDPGLIFHPPLLYMGYVGFSVAFAFALASLLRG----------EL---------------DSACARICRPWTLAAWSFL  166 (576)
T ss_pred             hcCCChhhhHHHHHHHHHHHHHHHHHHHHHHHhc----------cc---------------hhHHHHHHHHHHHHHHHHH
Confidence            345799998887554        66777777643          10               11122222  256778888


Q ss_pred             HHHHHHhhhhhhcCCCCCcchhhhhhhhhhH------------HHhhhhchhe
Q 022600          173 LLALFLGSSLLTLGSSCSVPLFWCYEIGSWG------------LVILYAGTAF  213 (294)
Q Consensus       173 llAlfLGsslLtLgssCSipLFWCYEi~~WG------------LViLyggTAF  213 (294)
                      -++|++|+             .|-|+...||            |+.....||+
T Consensus       167 t~Gi~~G~-------------~WAy~~l~WGg~W~WDPvE~~Sli~WL~y~a~  206 (576)
T TIGR00353       167 TLGIVLGS-------------WWAYYELGWGGWWFWDPVENASLMPWLSGTAL  206 (576)
T ss_pred             HHHHHHHH-------------HHhccccccCCCcCccHHHHHHHHHHHHHHHH
Confidence            88888887             4777655544            5555555663


No 6  
>PRK00418 DNA gyrase inhibitor; Reviewed
Probab=39.35  E-value=13  Score=28.64  Aligned_cols=14  Identities=50%  Similarity=0.693  Sum_probs=10.1

Q ss_pred             cCCCCCCcccccccc
Q 022600           61 SDYGRRPFCSDVRLQ   75 (294)
Q Consensus        61 ~~~~~rpFC~~rRL~   75 (294)
                      .++.-||||++ |=+
T Consensus        20 ~~~~~rPFCS~-RCk   33 (62)
T PRK00418         20 EISPFRPFCSK-RCQ   33 (62)
T ss_pred             CCCCcCCcccH-HHH
Confidence            35678999998 533


No 7  
>PRK05529 cell division protein FtsQ; Provisional
Probab=39.13  E-value=42  Score=30.40  Aligned_cols=45  Identities=20%  Similarity=0.268  Sum_probs=29.8

Q ss_pred             hhHHHHhhcCChhHHhhhhhhhhhhhhhchhHHHHHHHHHHHHHHH
Q 022600            4 IGDALRQAFMPKHEYERIREEDKAWVKLQRPFLISALTLICIVVAV   49 (294)
Q Consensus         4 ~gDALrQaFMpk~~Ye~LReeekaw~kLqrPl~~~~~~~v~~av~v   49 (294)
                      +|-.+|++-+-+++|+.+|-=-+- .+.+|+++.++++++.+.+++
T Consensus         7 ~~~~~~~~~~~~~~~~~~~~~~~~-~~~r~~~~~~~~~~~~~l~~l   51 (255)
T PRK05529          7 AYQNLRYARKERKDYERVRRFTTR-IRRRFILLACAVGAVLTLLLF   51 (255)
T ss_pred             hhhhhhhhcccCCchhhhhchhhh-ccchhhhHHHHHHHHHHHHHH
Confidence            567789988889999996654443 344577777666655444333


No 8  
>PRK01343 zinc-binding protein; Provisional
Probab=38.25  E-value=14  Score=27.99  Aligned_cols=14  Identities=36%  Similarity=0.781  Sum_probs=9.6

Q ss_pred             CCCCCcccccccccc
Q 022600           63 YGRRPFCSDVRLQPL   77 (294)
Q Consensus        63 ~~~rpFC~~rRL~~l   77 (294)
                      ...||||++ |=+-+
T Consensus        21 ~~~rPFCS~-RC~~i   34 (57)
T PRK01343         21 REAYPFCSE-RCRDI   34 (57)
T ss_pred             CCCCcccCH-HHhhh
Confidence            467999998 54333


No 9  
>COG4993 Gcd Glucose dehydrogenase [Carbohydrate transport and metabolism]
Probab=37.57  E-value=21  Score=38.30  Aligned_cols=49  Identities=37%  Similarity=0.611  Sum_probs=35.1

Q ss_pred             HHHHHHHHHHHHHHhhhhhhcCCCCCcchhhhhhhhhhHHHhhhhchheeeecccee
Q 022600          165 AVFAIIFGLLALFLGSSLLTLGSSCSVPLFWCYEIGSWGLVILYAGTAFFLRRKSAA  221 (294)
Q Consensus       165 ~vFaiifgllAlfLGsslLtLgssCSipLFWCYEi~~WGLViLyggTAFFLrRKAAv  221 (294)
                      .++.+.-||--+.-|.-|++||-|      |-|=|+  ||++|..+--.|+||+||+
T Consensus         7 ~~~~~~~gl~l~~gg~~l~~lggs------~yy~ia--gl~~l~~~~ll~~~k~aal   55 (773)
T COG4993           7 ALVIALCGLALLIGGIWLVALGGS------WYYLIA--GLVLLLSAWLLLRRKRAAL   55 (773)
T ss_pred             HHHHHHHHHHHhccceeEEeeCCc------hHHHHH--HHHHHHHHHHHhccchhHH
Confidence            334444455444556778899987      777776  8888888888888888875


No 10 
>PF04893 Yip1:  Yip1 domain;  InterPro: IPR006977 This entry contains proteins belonging to the Yip1 family and represents the Yip1 domain. The Yip1 integral membrane domain contains four transmembrane alpha helices. The domain is characterised by the motifs DLYGP and GY. The Yip1 protein is a golgi protein involved in vesicular transport that interacts with GTPases [].; GO: 0016020 membrane
Probab=36.63  E-value=39  Score=26.18  Aligned_cols=38  Identities=18%  Similarity=0.298  Sum_probs=23.3

Q ss_pred             CChhHHhhhhhhhhhhhhhchhHHHHHHHHHHHHHHHH
Q 022600           13 MPKHEYERIREEDKAWVKLQRPFLISALTLICIVVAVC   50 (294)
Q Consensus        13 Mpk~~Ye~LReeekaw~kLqrPl~~~~~~~v~~av~v~   50 (294)
                      =|++.+|+++++++.-.....|+...++....++.+.+
T Consensus         4 ~P~~~f~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~   41 (172)
T PF04893_consen    4 SPREFFRRLRESPRISKSWWLPLLLVILLTLVFGLLSS   41 (172)
T ss_pred             CHHHHHHHHHhccccchhHHHHHHHHHHHHHHHHHHHH
Confidence            48999999999998222334455555544444444443


No 11 
>PF06103 DUF948:  Bacterial protein of unknown function (DUF948);  InterPro: IPR009293 This family consists of bacterial sequences several of which are thought to be general stress proteins.
Probab=33.27  E-value=38  Score=25.58  Aligned_cols=23  Identities=35%  Similarity=0.469  Sum_probs=20.0

Q ss_pred             HHHHHHHHHHHHHHHhhhhhhcC
Q 022600          164 NAVFAIIFGLLALFLGSSLLTLG  186 (294)
Q Consensus       164 N~vFaiifgllAlfLGsslLtLg  186 (294)
                      .+++||.|.++++||..++..++
T Consensus         3 ~lI~Aiaf~vLvi~l~~~l~~l~   25 (90)
T PF06103_consen    3 GLIAAIAFAVLVIFLIKVLKKLK   25 (90)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            46899999999999999988774


No 12 
>PF04156 IncA:  IncA protein;  InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion. The inclusion is nonfusogenic with lysosomes but intercepts lipids from a host cell exocytic pathway. Initiation of chlamydial development is concurrent with modification of the inclusion membrane by a set of C. trachomatis-encoded proteins collectively designated Incs. One of these Incs, IncA (Inclusion membrane protein A), is functionally associated with the homotypic fusion of inclusions [].
Probab=32.25  E-value=40  Score=28.18  Aligned_cols=62  Identities=26%  Similarity=0.360  Sum_probs=30.7

Q ss_pred             chhhhHHHHHHHHHHHHHHHHhhhhhhcCCC-CCcchhhhhhhhh--hHHHhhhhchheeeecccee
Q 022600          158 RCLSILNAVFAIIFGLLALFLGSSLLTLGSS-CSVPLFWCYEIGS--WGLVILYAGTAFFLRRKSAA  221 (294)
Q Consensus       158 RCLsiLN~vFaiifgllAlfLGsslLtLgss-CSipLFWCYEi~~--WGLViLyggTAFFLrRKAAv  221 (294)
                      +|-.|.|++. ++.|++-+..|...|+++.. ++.+..=.=-++.  =|+|++=+|..+++ +|..+
T Consensus         2 ~~~~i~~i~~-iilgilli~~gI~~Lv~~~~~l~~~~s~~lg~~~lAlg~vL~~~g~~~~~-~~~~~   66 (191)
T PF04156_consen    2 KKQRIISIIL-IILGILLIASGIAALVLFISGLGALISFILGIALLALGVVLLSLGLLCLL-SKRPV   66 (191)
T ss_pred             hhHHHHHHHH-HHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHH-Hcccc
Confidence            3555666654 55566666666666666542 4443332222222  24444445554444 44444


No 13 
>PF12911 OppC_N:  N-terminal TM domain of oligopeptide transport permease C
Probab=32.05  E-value=67  Score=22.05  Aligned_cols=29  Identities=17%  Similarity=0.487  Sum_probs=19.1

Q ss_pred             hhhhhh-chhHHHHHHHHHHHHHHHHhhhe
Q 022600           26 KAWVKL-QRPFLISALTLICIVVAVCTIVS   54 (294)
Q Consensus        26 kaw~kL-qrPl~~~~~~~v~~av~v~~~is   54 (294)
                      ++|.++ +.|+++.+++++.+.+++|....
T Consensus         7 ~~~~~f~~nk~a~~gl~il~~~vl~ai~~p   36 (56)
T PF12911_consen    7 DAWRRFRRNKLAVIGLIILLILVLLAIFAP   36 (56)
T ss_pred             HHHHHHHhCchHHHHHHHHHHHHHHHHHHH
Confidence            456654 45788888877777666665543


No 14 
>PF03900 Porphobil_deamC:  Porphobilinogen deaminase, C-terminal domain;  InterPro: IPR022418 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway []. The end-product, uroporphyrinogen III, is used to synthesise a number of important molecules, including vitamin B12, haem, sirohaem, chlorophyll, coenzyme F430 and phytochromobilin [].   The first stage in tetrapyrrole synthesis is the synthesis of 5-aminoaevulinic acid ALA via two possible routes: (1) condensation of succinyl CoA and glycine (C4 pathway) using ALA synthase (2.3.1.37 from EC), or (2) decarboxylation of glutamate (C5 pathway) via three different enzymes, glutamyl-tRNA synthetase (6.1.1.17 from EC) to charge a tRNA with glutamate, glutamyl-tRNA reductase (1.2.1.70 from EC) to reduce glutamyl-tRNA to glutamate-1-semialdehyde (GSA), and GSA aminotransferase (5.4.3.8 from EC) to catalyse a transamination reaction to produce ALA.     The second stage is to convert ALA to uroporphyrinogen III, the first macrocyclic tetrapyrrolic structure in the pathway. This is achieved by the action of three enzymes in one common pathway: porphobilinogen (PBG) synthase (or ALA dehydratase, 4.2.1.24 from EC) to condense two ALA molecules to generate porphobilinogen; hydroxymethylbilane synthase (or PBG deaminase, 2.5.1.61 from EC) to polymerise four PBG molecules into preuroporphyrinogen (tetrapyrrole structure); and uroporphyrinogen III synthase (4.2.1.75 from EC) to link two pyrrole units together (rings A and D) to yield uroporphyrinogen III.     Uroporphyrinogen III is the first branch point of the pathway. To synthesise cobalamin (vitamin B12), sirohaem, and coenzyme F430, uroporphyrinogen III needs to be converted into precorrin-2 by the action of uroporphyrinogen III methyltransferase (2.1.1.107 from EC). To synthesise haem and chlorophyll, uroporphyrinogen III needs to be decarboxylated into coproporphyrinogen III by the action of uroporphyrinogen III decarboxylase (4.1.1.37 from EC) [].   Porphobilinogen deaminase (also known as hydroxymethylbilane synthase, 2.5.1.61 from EC) functions during the second stage of tetrapyrrole biosynthesis. This enzyme catalyses the polymerisation of four PBG molecules into the tetrapyrrole structure, preuroporphyrinogen, with the concomitant release of four molecules of ammonia. This enzyme uses a unique dipyrro-methane cofactor made from two molecules of PBG, which is covalently attached to a cysteine side chain. The tetrapyrrole product is synthesized in an ordered, sequential fashion, by initial attachment of the first pyrrole unit (ring A) to the cofactor, followed by subsequent additions of the remaining pyrrole units (rings B, C, D) to the growing pyrrole chain []. The link between the pyrrole ring and the cofactor is broken once all the pyrroles have been added. This enzyme is folded into three distinct domains that enclose a single, large active site that makes use of an aspartic acid as its one essential catalytic residue, acting as a general acid/base during catalysis [, ]. A deficiency of hydroxymethylbilane synthase is implicated in the neuropathic disease, Acute Intermittent Porphyria (AIP) [].  This entry represents the C-terminal domain of porphobilinogen deaminase, an enzyme involved in tetrapyrrole biosynthesis. The structure of this alpha/beta domain consists of alpha-beta(3)-alpha in two layers []. Porphobilinogen deaminase has a three-domain structure. Domains 1 (N-terminal) and 2 are duplications with the same structure, resembling the transferrins and periplasmic binding proteins. The dipyrromethane cofactor is covalently linked to domain 3 (C-terminal), but is bound by extensive salt-bridges and hydrogen-bonds within the cleft between domains 1 and 2, at a position corresponding to the binding sites for small-molecule ligands in the analogous proteins []. The enzyme has a single catalytic site, and the flexibility between domains is thought to aid elongation of the polypyrrole product in the active-site cleft of the enzyme.; GO: 0033014 tetrapyrrole biosynthetic process; PDB: 3EQ1_B 3ECR_A 1GTK_A 1AH5_A 2YPN_A 1PDA_A 1YPN_A.
Probab=29.85  E-value=24  Score=26.13  Aligned_cols=14  Identities=36%  Similarity=0.767  Sum_probs=9.6

Q ss_pred             hhhhhcCCCCCcch
Q 022600          180 SSLLTLGSSCSVPL  193 (294)
Q Consensus       180 sslLtLgssCSipL  193 (294)
                      ++|=+||.+|++|+
T Consensus         9 ~fl~~l~ggC~~Pi   22 (74)
T PF03900_consen    9 AFLKELGGGCHSPI   22 (74)
T ss_dssp             HHHHHCT--TTSSE
T ss_pred             HHHHHhCCCCCCce
Confidence            35678999999996


No 15 
>PF11998 DUF3493:  Protein of unknown function (DUF3493);  InterPro: IPR021883  This family of proteins is functionally uncharacterised. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 79 to 331 amino acids in length. 
Probab=29.31  E-value=1e+02  Score=24.40  Aligned_cols=28  Identities=32%  Similarity=0.431  Sum_probs=21.0

Q ss_pred             CChhHHhhhhhhhhh-hhhhchhHHHHHH
Q 022600           13 MPKHEYERIREEDKA-WVKLQRPFLISAL   40 (294)
Q Consensus        13 Mpk~~Ye~LReeeka-w~kLqrPl~~~~~   40 (294)
                      |..+.|+.||.|-++ |+.+++=+..+..
T Consensus         1 ~~~~~~~rLraE~~aPfR~lR~f~y~a~~   29 (75)
T PF11998_consen    1 MDPEQYARLRAEAQAPFRGLRRFFYGAFG   29 (75)
T ss_pred             CCHHHHHHHHHHHHCchHHHHHHHHHHHH
Confidence            778899999999988 5577766554443


No 16 
>KOG4681 consensus Uncharacterized conserved protein [Function unknown]
Probab=28.40  E-value=36  Score=32.84  Aligned_cols=29  Identities=45%  Similarity=0.834  Sum_probs=21.8

Q ss_pred             ccCCcc---chhhhHHHHHHHHHHHHHHHHhhhhh
Q 022600          152 SKRGGV---RCLSILNAVFAIIFGLLALFLGSSLL  183 (294)
Q Consensus       152 SkRGGV---RCLsiLN~vFaiifgllAlfLGsslL  183 (294)
                      |++|++   +|.-   ..|.+.|++|.|.||+.-|
T Consensus        50 s~~g~~~~g~c~~---~~~g~sf~lmglvlgg~~l   81 (280)
T KOG4681|consen   50 SKVGWVMEGGCFD---LLFGLSFGLMGLVLGGAYL   81 (280)
T ss_pred             hhccCccCcchHH---HHHhHHHHHHhhhccccee
Confidence            555544   3544   7899999999999998765


No 17 
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.08  E-value=24  Score=27.74  Aligned_cols=18  Identities=33%  Similarity=0.683  Sum_probs=11.9

Q ss_pred             eecCCCCCCcccccccccc
Q 022600           59 FPSDYGRRPFCSDVRLQPL   77 (294)
Q Consensus        59 Fp~~~~~rpFC~~rRL~~l   77 (294)
                      .-.++.-||||++ |-|-+
T Consensus        19 w~~~s~frPFCSk-RCklI   36 (65)
T COG3024          19 WGEESPFRPFCSK-RCKLI   36 (65)
T ss_pred             ccccCCcCcchhH-hhhhc
Confidence            3345578999998 64433


No 18 
>PF11239 DUF3040:  Protein of unknown function (DUF3040);  InterPro: IPR021401  Some members in this family of proteins with unknown function are annotated as membrane proteins however this cannot be confirmed. 
Probab=27.96  E-value=38  Score=25.78  Aligned_cols=15  Identities=33%  Similarity=0.775  Sum_probs=12.6

Q ss_pred             hhhhHHHhhhhchhe
Q 022600          199 IGSWGLVILYAGTAF  213 (294)
Q Consensus       199 i~~WGLViLyggTAF  213 (294)
                      +..||+++..+|..+
T Consensus        67 ~~v~G~~v~~~~~~~   81 (82)
T PF11239_consen   67 LGVAGFVVMVAGAVW   81 (82)
T ss_pred             HHHHHHHHHHHHHHh
Confidence            788999999988754


No 19 
>PF07423 DUF1510:  Protein of unknown function (DUF1510);  InterPro: IPR009988 This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown.
Probab=25.65  E-value=65  Score=29.61  Aligned_cols=20  Identities=25%  Similarity=0.276  Sum_probs=14.0

Q ss_pred             hhHHHHHHHHHHHHHHHHhh
Q 022600          161 SILNAVFAIIFGLLALFLGS  180 (294)
Q Consensus       161 siLN~vFaiifgllAlfLGs  180 (294)
                      .|||+.++|...|..++++.
T Consensus        14 ~iLNiaI~IV~lLIiiva~~   33 (217)
T PF07423_consen   14 KILNIAIGIVSLLIIIVAYQ   33 (217)
T ss_pred             hhHHHHHHHHHHHHHHHhhh
Confidence            58999999888555544443


No 20 
>PF04156 IncA:  IncA protein;  InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion. The inclusion is nonfusogenic with lysosomes but intercepts lipids from a host cell exocytic pathway. Initiation of chlamydial development is concurrent with modification of the inclusion membrane by a set of C. trachomatis-encoded proteins collectively designated Incs. One of these Incs, IncA (Inclusion membrane protein A), is functionally associated with the homotypic fusion of inclusions [].
Probab=25.29  E-value=66  Score=26.89  Aligned_cols=26  Identities=42%  Similarity=0.653  Sum_probs=17.2

Q ss_pred             HHHHHHHHHHHHHHHHhhhhhhcCCC
Q 022600          163 LNAVFAIIFGLLALFLGSSLLTLGSS  188 (294)
Q Consensus       163 LN~vFaiifgllAlfLGsslLtLgss  188 (294)
                      +-.++.++-|...+.+|..++++|-.
T Consensus        33 l~~~~s~~lg~~~lAlg~vL~~~g~~   58 (191)
T PF04156_consen   33 LGALISFILGIALLALGVVLLSLGLL   58 (191)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            44556666666677777777777753


No 21 
>KOG3879 consensus Predicted membrane protein [Function unknown]
Probab=25.19  E-value=66  Score=30.91  Aligned_cols=30  Identities=27%  Similarity=0.441  Sum_probs=22.8

Q ss_pred             ccccceeeEEeeehhhHHHHHHHHHHHhhc
Q 022600           99 DQETVDYYWMVVFIPSTIIFLASIVYLVAG  128 (294)
Q Consensus        99 ~~Ea~dyyWmVvF~Ps~v~f~~S~~YL~AG  128 (294)
                      -.+-++.=|.|||+|.-|+-.++.+|++--
T Consensus        77 LD~~v~WnW~VVFvPlWI~~sil~V~VLy~  106 (267)
T KOG3879|consen   77 LDKIVHWNWFVVFVPLWIFDSILLVVVLYK  106 (267)
T ss_pred             cCcccCCceEEEeehHHHHHHHHHHHHHHH
Confidence            346788999999999988777766665543


No 22 
>KOG1176 consensus Acyl-CoA synthetase [Lipid transport and metabolism]
Probab=23.85  E-value=45  Score=33.79  Aligned_cols=29  Identities=38%  Similarity=0.720  Sum_probs=19.7

Q ss_pred             CCcchhhhhhhhhhHHHhhhhchh-eeeec
Q 022600          189 CSVPLFWCYEIGSWGLVILYAGTA-FFLRR  217 (294)
Q Consensus       189 CSipLFWCYEi~~WGLViLyggTA-FFLrR  217 (294)
                      |..|+||||=..+=....+.+||. .++|+
T Consensus       230 ~~lPl~H~~Gl~~~~~~~~~~~~~ii~~~~  259 (537)
T KOG1176|consen  230 CTLPLFHIYGLITLLLSLLAGGTTIICLRK  259 (537)
T ss_pred             EechHHHHhHHHHHHHHHHhCCceEEECCC
Confidence            889999999877655544555544 44554


No 23 
>PF01284 MARVEL:  Membrane-associating domain;  InterPro: IPR021128 This entry represents the ~130-residue MARVEL (MAL and related proteins for vesicle trafficking and membrane link) domain. The MARVEL domain is a module with a four transmembrane-helix architecture that has been identified in proteins of the myelin and lymphocyte (MAL), physins, gyrins and occludin families. All described MARVEL domain-containing proteins are consistent with the M-shaped topology: four transmembrane-helix region architecture with cytoplasmic N- and C-terminal regions. Their function could be related to cholesterol-rich membrane apposition events in a variety of cellular processes, such as biogenesis of vesicular transport carriers or tight junction regulation [].
Probab=23.79  E-value=94  Score=23.78  Aligned_cols=24  Identities=21%  Similarity=0.163  Sum_probs=19.7

Q ss_pred             HHHHHHHHhhceeeeeeCCCccce
Q 022600          118 FLASIVYLVAGITVAYTAPRRHGC  141 (294)
Q Consensus       118 f~~S~~YL~AGi~VAYsAP~RH~c  141 (294)
                      .+..+.||.+++..|...++.|-+
T Consensus        84 ~v~~il~l~a~~~~a~~~~~~~~~  107 (144)
T PF01284_consen   84 AVFAILWLAAFIALAAYLSDHSCS  107 (144)
T ss_pred             HHHHHHHHHHHHHHHHHhcCcccc
Confidence            466788999999999988887765


No 24 
>PF07328 VirD1:  T-DNA border endonuclease VirD1;  InterPro: IPR009933 This family consists of several T-DNA border endonuclease VirD1 proteins, which appear to be found exclusively in Agrobacterium species. Agrobacterium, a plant pathogen, is capable to stably transform the plant cell with a segment of its own DNA called T-DNA (transferred DNA). This process depends, among others, on the specialised bacterial virulence proteins VirD1 and VirD2 that excise the T-DNA from its adjacent sequences. VirD1 is thought to interact with VirD2 in this process [].; GO: 0004519 endonuclease activity
Probab=23.45  E-value=42  Score=29.85  Aligned_cols=20  Identities=40%  Similarity=0.581  Sum_probs=18.0

Q ss_pred             CChhHHhhhhhhhhhhhhhc
Q 022600           13 MPKHEYERIREEDKAWVKLQ   32 (294)
Q Consensus        13 Mpk~~Ye~LReeekaw~kLq   32 (294)
                      -|+-|||++++|-|+++|.-
T Consensus       100 ~~~pd~e~f~aER~~fGk~f  119 (147)
T PF07328_consen  100 TPRPDYEAFRAERKAFGKEF  119 (147)
T ss_pred             CCCccHHHHHHHHHHHHHHH
Confidence            69999999999999999754


No 25 
>PF03522 KCl_Cotrans_1:  K-Cl Co-transporter type 1 (KCC1);  InterPro: IPR018491 The K-Cl co-transporter (KCC) mediates the coupled movement of K+ and Cl- ions across the plasma membrane of many animal cells. This transport is involved in the regulatory volume decrease in response to cell swelling in red blood cells, and has been proposed to play a role in the vectorial movement of Cl- across kidney epithelia. The transport process involves one for one electroneutral movement of K+ together with Cl-, and, in all known mammalian cells, the net movement is outward []. In neurones, it appears to play a unique role in maintaining low intracellular Cl-concentration, which is required for the functioning of Cl- dependent fast synaptic inhibition, mediated by certain neurotransmitters, such as gamma-aminobutyric acid (GABA) and glycine. Three isoforms of the K-Cl co-transporter have been described, termed KCC1 KCC2, and KCC3, containing 1085, 1116 and 1150 amino acids, respectively. They are predicted to have 12 transmembrane (TM) regions in a central hydrophobic domain, together with hydrophilic N- and C-termini that are likely cytoplasmic. Comparison of their sequences with those of other ion-tranporting membrane proteins reveals that they are part of a new superfamily of cation-chloride co-transporters, which includes the Na-Cl and Na-K-2Cl co-transporters. KCC1 and KCC3 are widely expressed in human tissues, while KCC2 is are expressed only in brain neurones, making it likely that this is the isoform responsible for maintaining low Cl- concentration in neurones [, , ]. KCC1 is widely expressed in human tissues, and when heterologously expressed, possesses the functional characteristics of the well-studied red blood cell K-Cl co-transporter, including stimulation by both swelling and N-ethylmaleimide. Several splice variants have also been identified. KCC3 is widely expressed in human tissues and, like KCC1, is stimulated by both swelling and N-ethylmaleimide. The induction of KCC3 is up-regulated by vascular endothelial growth factor and down-regulated by tumour necrosis factor. Defects in KCC3 are linked to agenesis of the corpus callosum with peripheral neuropathy []. This disorder is characterised by severe progressive sensorimotor neuropathy, mental retardation, dysmorphic features and complete or partial agenesis of the corpus callosum.; GO: 0005215 transporter activity, 0006811 ion transport, 0016020 membrane
Probab=23.11  E-value=39  Score=23.26  Aligned_cols=13  Identities=46%  Similarity=0.521  Sum_probs=7.7

Q ss_pred             CCCCCCCCCCccc
Q 022600          266 LSSDEEDEPDDYL  278 (294)
Q Consensus       266 LSsDeE~e~d~y~  278 (294)
                      |-||||||.+-+.
T Consensus        13 lySDeeeE~~~~~   25 (30)
T PF03522_consen   13 LYSDEEEETETEP   25 (30)
T ss_pred             cccCcccccccch
Confidence            3466677776443


No 26 
>KOG0347 consensus RNA helicase [RNA processing and modification]
Probab=22.75  E-value=46  Score=35.58  Aligned_cols=46  Identities=35%  Similarity=0.421  Sum_probs=35.4

Q ss_pred             eccCCCCCCcccchhhhhcCCCCCChh-hhhhhhhhhhhcccccCCCCCC
Q 022600          222 VFDDGDSDGRNLGVEMLEANPLEVTPD-VERRVSEGFKTWMGSSFLSSDE  270 (294)
Q Consensus       222 ilDeg~~~~~~~GlEmLEa~p~evtpe-~erRvn~GFksWMGsSlLSsDe  270 (294)
                      ++| |||++ +.|+|-|-.- .+|+|+ ++.++.-+=|-|=-.+.-|..|
T Consensus        35 ~~D-g~fd~-~~gle~l~~~-q~v~~~~~p~k~~~~~kkk~Kv~k~~~~E   81 (731)
T KOG0347|consen   35 AMD-GDFDG-LYGLEELDDY-QEVLPKVVPGKVTKVEKKKRKVKKVSNEE   81 (731)
T ss_pred             ccC-CCccc-eechheecch-hhhccccCchhhhhhhhhhhcccCccccc
Confidence            567 89999 9999999888 777775 6778888888887666555443


No 27 
>PF10945 DUF2629:  Protein of unknown function (DUF2629);  InterPro: IPR024487 Some members in this family of proteins are annotated as YhjR however currently no function is known.
Probab=21.91  E-value=74  Score=23.34  Aligned_cols=31  Identities=45%  Similarity=0.687  Sum_probs=22.2

Q ss_pred             HHHHhhc-CChhHHhhhhhhhhhhhhhch-hHH
Q 022600            6 DALRQAF-MPKHEYERIREEDKAWVKLQR-PFL   36 (294)
Q Consensus         6 DALrQaF-Mpk~~Ye~LReeekaw~kLqr-Pl~   36 (294)
                      .+|+|+| ||+=+|--+-.||+.=.-++| ||+
T Consensus         7 ~~L~~~fslp~~~Y~DIsr~e~l~~~~~RWPLL   39 (44)
T PF10945_consen    7 AALSQAFSLPDINYIDISREERLNQALQRWPLL   39 (44)
T ss_pred             HHHHHHhCCCCccHHHHHHHHHHHHHHHHChhH
Confidence            4899999 999999888777765233333 443


No 28 
>PF07708 Tash_PEST:  Tash protein PEST motif;  InterPro: IPR011695 The PEST motif is found in one or more copies in Tash AT-hook proteins from Theileria annulata. Tash proteins are transported to the host nucleus and are thought to be involved in pathogenesis []. The PEST motif is often found in conjunction with the (IPR007480 from INTERPRO), whose function is unknown. These repeats may be part of the PEST motif (a signal for rapid proteolytic degradation) [], though this is not proven. This motif is also found in other T. annulata proteins, which have no other known domains.
Probab=21.84  E-value=43  Score=21.00  Aligned_cols=8  Identities=63%  Similarity=0.983  Sum_probs=4.3

Q ss_pred             CCCCCCCC
Q 022600          266 LSSDEEDE  273 (294)
Q Consensus       266 LSsDeE~e  273 (294)
                      ++||||+|
T Consensus        12 i~SDeeee   19 (19)
T PF07708_consen   12 IGSDEEEE   19 (19)
T ss_pred             ecccccCC
Confidence            45665543


No 29 
>PF03739 YjgP_YjgQ:  Predicted permease YjgP/YjgQ family;  InterPro: IPR005495 Members of this family are predicted integral membrane proteins of unknown function. They are about 350 amino acids long, contain about 6 transmembrane regions and may be permeases, although there is no verification of this.; GO: 0016021 integral to membrane
Probab=21.62  E-value=94  Score=27.69  Aligned_cols=53  Identities=26%  Similarity=0.474  Sum_probs=42.2

Q ss_pred             hHHHHHHHHHHHHHHHHhhhhhhcCCCCCcchhhhhhhhhhHHHhhhhchheeeecc
Q 022600          162 ILNAVFAIIFGLLALFLGSSLLTLGSSCSVPLFWCYEIGSWGLVILYAGTAFFLRRK  218 (294)
Q Consensus       162 iLN~vFaiifgllAlfLGsslLtLgssCSipLFWCYEi~~WGLViLyggTAFFLrRK  218 (294)
                      ..++..+++++++=.++.....++|.+=-+|-+|    +.|.-.++++..++++-||
T Consensus       302 ~~~~~~~l~~~~~~~~~~~~~~~l~~~~~l~p~~----a~w~p~ii~~~~~~~l~~R  354 (354)
T PF03739_consen  302 ISSLFIALLLGFLYYILFSFFSSLGENGNLPPFI----AAWLPNIIFLILGLYLLRR  354 (354)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHcCCccHHH----HHHHHHHHHHHHHHHHHhC
Confidence            4557778888888777778888888888888887    7899999999888876554


No 30 
>TIGR03089 conserved hypothetical protein TIGR03089. This protein family is found, so far, only in the Actinobacteria (Streptomyces, Mycobacterium, Corynebacterium, Nocardia, Propionibacterium, etc.) and never more than one to a genome. Members show twilight-level sequence similarity to family of AMP-binding enzymes described by Pfam model pfam00501.
Probab=21.45  E-value=60  Score=28.11  Aligned_cols=27  Identities=4%  Similarity=-0.135  Sum_probs=18.5

Q ss_pred             CcchhhhhhhhhhH-HHhhhhchheeee
Q 022600          190 SVPLFWCYEIGSWG-LVILYAGTAFFLR  216 (294)
Q Consensus       190 SipLFWCYEi~~WG-LViLyggTAFFLr  216 (294)
                      -.||||+|-..+-. ..+..|||..+++
T Consensus       183 ~~Pl~H~~gl~~~~~~~l~~G~t~v~~~  210 (227)
T TIGR03089       183 VLAWTDLEDFLATLLAPLAAGGSLVLVT  210 (227)
T ss_pred             ecCCCchHHHHHHHHHHhccCceEEEec
Confidence            46999999986544 4445577766664


No 31 
>PF03383 Serpentine_r_xa:  Caenorhabditis serpentine receptor-like protein, class xa;  InterPro: IPR005047 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents serpentine receptor class xa (Srxa), from the Str superfamily [].
Probab=21.44  E-value=52  Score=28.83  Aligned_cols=18  Identities=33%  Similarity=0.610  Sum_probs=12.7

Q ss_pred             HHHHhhcCChhHHhhhhh
Q 022600            6 DALRQAFMPKHEYERIRE   23 (294)
Q Consensus         6 DALrQaFMpk~~Ye~LRe   23 (294)
                      |..-.-++|++.||..|.
T Consensus        24 ~~~~~~~~~~~~Y~~yr~   41 (153)
T PF03383_consen   24 DFWIPLFLPDEGYEEYRQ   41 (153)
T ss_pred             hhhhhhccChhHHHHHHH
Confidence            333344799999998873


No 32 
>COG3230 HemO Heme oxygenase [Inorganic ion transport and metabolism]
Probab=21.06  E-value=34  Score=31.61  Aligned_cols=45  Identities=29%  Similarity=0.507  Sum_probs=31.1

Q ss_pred             chheeeeccceeeccCCCCCCcc-------cc------hhhhhcCCCCCChhhhhhhhhhh
Q 022600          210 GTAFFLRRKSAAVFDDGDSDGRN-------LG------VEMLEANPLEVTPDVERRVSEGF  257 (294)
Q Consensus       210 gTAFFLrRKAAvilDeg~~~~~~-------~G------lEmLEa~p~evtpe~erRvn~GF  257 (294)
                      |.||.+++-|.+=+++ +||.+-       .|      +|.|+++  ++|||-|+++.+|=
T Consensus       123 GaAfL~K~aa~L~l~~-e~garhLag~~~grG~~WrsF~e~L~~~--~l~~E~e~~av~gA  180 (196)
T COG3230         123 GAAFLFKHAAKLGLNP-EFGARHLAGYGDGRGKRWRSFVEHLDAI--NLTPEAEAEAVAGA  180 (196)
T ss_pred             HHHHHHHHHHHhcCCc-ccchHhhcCCCCCCCccHHHHHHHHHhc--cCCHHHHHHHHHHH
Confidence            4577777766655555 455433       22      5788875  78999999999983


No 33 
>COG0117 RibD Pyrimidine deaminase [Coenzyme metabolism]
Probab=20.93  E-value=68  Score=28.34  Aligned_cols=44  Identities=27%  Similarity=0.360  Sum_probs=32.2

Q ss_pred             ccceeeccCCCCCCcccchhhhhcCCCCCCh----hhhhhhhhhhhhcc
Q 022600          217 RKSAAVFDDGDSDGRNLGVEMLEANPLEVTP----DVERRVSEGFKTWM  261 (294)
Q Consensus       217 RKAAvilDeg~~~~~~~GlEmLEa~p~evtp----e~erRvn~GFksWM  261 (294)
                      |=-..++|....-. ..|+++|++..+||.-    +-.++.|+||+.||
T Consensus        98 rVvva~~DPnp~Va-g~G~~~L~~aGi~V~~gil~~e~~~l~~~f~~~~  145 (146)
T COG0117          98 RVVVAMLDPNPLVA-GGGLARLRAAGIEVEVGILEEEAEKLNEGFLKRM  145 (146)
T ss_pred             EEEEEecCCCcccc-CchHHHHHHcCCeEEEehhHHHHHHHHHHHHccc
Confidence            33345677733444 6799999999988753    45678999999997


Done!