Citrus Sinensis ID: 022607


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290----
MSQSSAAKTKGRSVVEDKLYPAPLSSHEDVSKDPIVFWDTLRRFHFIMGTKFMIPVIGGKELDLHVLYVEATTRGGYEKVVAEKKWREVGAVFKFSPTTTSASFVLRKHYLTLLYHYEQVHFFKMQGPPCVPSASFSVHSPSCRPGLALVEYSPKRINDHPDSHIEGQSCFTAVGRIDGKFDCGYLVSVKLGSETLSGVLYHPDHPGPSTSFCQSNDVGAIIPYTPNSKRRYGRRRRSKRRGDPSYPKPNRSGYNFFFAEKHYKLKSLYPNREREFTKMIGESWTNLSPEERKV
cccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccEEcccccHHHHHHHHHHHcccHHHHHccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHccc
********************************DPIVFWDTLRRFHFIMGTKFMIPVIGGKELDLHVLYVEATTRGGYEKVVAEKKWREVGAVFKFSPTTTSASFVLRKHYLTLLYHYEQVHFF*********************************************SCFTAVGRIDGKFDCGYLVSVKLGSETLSGVLYHP*************************************************GYNFFFAEKHYKLKSLYPNR***FT****ESWTNL*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQSSAAKTKGRSVVEDKLYPAPLSSHEDVSKDPIVFWDTLRRFHFIMGTKFMIPVIGGKELDLHVLYVEATTRGGYEKVVAEKKWREVGAVFKFSPTTTSASFVLRKHYLTLLYHYEQVHFFKMQGPPCVPSASFSVHSPSCRPGLALVEYSPKRINDHPDSHIEGQSCFTAVGRIDGKFDCGYLVSVKLGSETLSGVLYHPDHPGPSTSFCQSNDVGAIIPYTPNSKRRYGRRRRSKRRGDPSYPKPNRSGYNFFFAEKHYKLKSLYPNREREFTKMIGESWTNLSPEERKV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
High mobility group B protein 9 Binds preferentially DNA with A/T-rich content.probableQ9SGS2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IG6, chain A
Confidence level:very confident
Coverage over the Query: 32-133
View the alignment between query and template
View the model in PyMOL
Template: 2YRQ, chain A
Confidence level:very confident
Coverage over the Query: 236-294
View the alignment between query and template
View the model in PyMOL