BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 022616
(294 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1Z1W|A Chain A, Crystal Structures Of The Tricorn Interacting Facor F3
From Thermoplasma Acidophilum, A Zinc Aminopeptidase In
Three Different Conformations
pdb|1Z5H|A Chain A, Crystal Structures Of The Tricorn Interacting Factor F3
From Thermoplasma Acidophilum
pdb|1Z5H|B Chain B, Crystal Structures Of The Tricorn Interacting Factor F3
From Thermoplasma Acidophilum
Length = 780
Score = 30.4 bits (67), Expect = 1.2, Method: Compositional matrix adjust.
Identities = 10/13 (76%), Positives = 12/13 (92%)
Query: 193 TMDIVFPDWSFWG 205
TMD +FP+WSFWG
Sbjct: 298 TMDTLFPEWSFWG 310
>pdb|3Q7J|A Chain A, Engineered Thermoplasma Acidophilum F3 Factor Mimics Human
Aminopeptidase N (Apn) As A Target For Anticancer Drug
Development
pdb|3Q7J|B Chain B, Engineered Thermoplasma Acidophilum F3 Factor Mimics Human
Aminopeptidase N (Apn) As A Target For Anticancer Drug
Development
Length = 780
Score = 30.4 bits (67), Expect = 1.2, Method: Compositional matrix adjust.
Identities = 10/13 (76%), Positives = 12/13 (92%)
Query: 193 TMDIVFPDWSFWG 205
TMD +FP+WSFWG
Sbjct: 298 TMDTLFPEWSFWG 310
>pdb|3QKW|A Chain A, Structure Of Streptococcus Parasangunini Gtf3
Glycosyltransferase
pdb|3QKW|B Chain B, Structure Of Streptococcus Parasangunini Gtf3
Glycosyltransferase
pdb|3QKW|C Chain C, Structure Of Streptococcus Parasangunini Gtf3
Glycosyltransferase
pdb|3QKW|D Chain D, Structure Of Streptococcus Parasangunini Gtf3
Glycosyltransferase
Length = 332
Score = 27.7 bits (60), Expect = 8.4, Method: Compositional matrix adjust.
Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 6/45 (13%)
Query: 208 EINIKPWESLLRELKEGNNGRNWID------REPYAYWKGNPFVA 246
+IN +P E LL E+ +G G W+D + Y +K F+A
Sbjct: 210 KINYRPDEQLLMEMSQGGFGLVWMDDKDKEYQSLYCSYKLGSFLA 254
>pdb|3RHZ|A Chain A, Structure And Functional Analysis Of A New Subfamily Of
Glycosyltransferases Required For Glycosylation Of
Serine-Rich Streptococcal Adhesions
pdb|3RHZ|B Chain B, Structure And Functional Analysis Of A New Subfamily Of
Glycosyltransferases Required For Glycosylation Of
Serine-Rich Streptococcal Adhesions
Length = 339
Score = 27.7 bits (60), Expect = 8.7, Method: Compositional matrix adjust.
Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 6/45 (13%)
Query: 208 EINIKPWESLLRELKEGNNGRNWID------REPYAYWKGNPFVA 246
+IN +P E LL E+ +G G W+D + Y +K F+A
Sbjct: 218 KINYRPDEQLLMEMSQGGFGLVWMDDKDKEYQSLYCSYKLGSFLA 262
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.136 0.450
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,693,069
Number of Sequences: 62578
Number of extensions: 424353
Number of successful extensions: 860
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 856
Number of HSP's gapped (non-prelim): 6
length of query: 294
length of database: 14,973,337
effective HSP length: 98
effective length of query: 196
effective length of database: 8,840,693
effective search space: 1732775828
effective search space used: 1732775828
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.3 bits)