Citrus Sinensis ID: 022641

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290----
MRANFGKIHKSGKNKSPNFTQKFSTTQSSPEKSEDEVKRKMAPVLQSSQPWVEKYRPKQVKDVAHQEEVVRVLTNTLETANCPHMLFYGPPGTGKTTTALAIAHQLFGPELYKSRVLELNASDDRGINVVRTKIKTFAAVAVGSGQRRGGYPCPPYKIIILDEADSMTEDAQNALRRTMETYSKVTRFFFICNYISRIIEPLASRCAKFRFKPLSEEVMSSRVLHICNEEGLNLDAEALSTLSSISQGDLRRAITYLQGAARLFGSSITSKDLISVSGYPTGGSGGAFRGVQKW
cccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHcccccccccEEEEcccccccHHHHHHHHHHHHHHccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHccccEECccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccHHHcccccccccHHHHHHHHcc
*************************************************PWVEKYRPKQVKDVAHQEEVVRVLTNTLETANCPHMLFYGPPGTGKTTTALAIAHQLFGPELYKSRVLELNASDDRGINVVRTKIKTFAAVAVGSGQRRGGYPCPPYKIIILDEADSMTEDAQNALRRTMETYSKVTRFFFICNYISRIIEPLASRCAKFRFKPLSEEVMSSRVLHICNEEGLNLDAEALSTLSSISQGDLRRAITYLQGAARLFGSSITSKDLISVSGYPTGGSGGAFRGVQKW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRANFGKIHKSGKNKSPNFTQKFSTTQSSPEKSEDEVKRKMAPVLQSSQPWVEKYRPKQVKDVAHQEEVVRVLTNTLETANCPHMLFYGPPGTGKTTTALAIAHQLFGPELYKSRVLELNASDDRGINVVRTKIKTFAAVAVGSGQRRGGYPCPPYKIIILDEADSMTEDAQNALRRTMETYSKVTRFFFICNYISRIIEPLASRCAKFRFKPLSEEVMSSRVLHICNEEGLNLDAEALSTLSSISQGDLRRAITYLQGAARLFGSSITSKDLISVSGYPTGGSGGAFRGVQKW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Replication factor C small subunit Part of the RFC clamp loader complex which loads the PCNA sliding clamp onto DNA.probableA1RWU7
Replication factor C small subunit Part of the RFC clamp loader complex which loads the PCNA sliding clamp onto DNA. The complex possesses DNA-dependent ATPase activity which is further stimulated by PCNA.probableO28219
Replication factor C subunit 4 The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1. This subunit may be involved in the elongation of the multiprimed DNA template.probableP35249

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SXJ, chain D
Confidence level:very confident
Coverage over the Query: 50-281
View the alignment between query and template
View the model in PyMOL