Citrus Sinensis ID: 022658


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290----
MDLDQWIAKVKEGQHLLEDELQLLCEYVKEILIEESNVQPVNSPVTVCGDIHGQFHDLMKLFQTGGHVPETNYIFMGDFVDRGYNSLEVFTILLLLKARYPANITLLRGNHESRQLTQVYGFYDECQRKYGNANAWRYCTDVFDYLTLSAIIDGTVLCVHGGLSPDIRTIDQIRVIERNCEIPHEGPFCDLMWSDPEDIETWAVSPRGAGWLFGSRVTSEFNHINNLDLVCRAHQLVQEGLKYMFQDKGLVTVWSAPNYCYRCGNVASILSFNENMVRYPACWHAGVCVCVCVF
ccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccEEEEccccccHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHcccccEEECccccccccccccccHHHHHHHHccccHHHHHHHHHHccccHHEEEcccEEEEccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccEEEEHHHHHccccEEEEccccEEEEEcccccccccccEEEEEEEccccccccEEEccccccccccc
MDLDQWIAKVKEGQHLLEDELQLLCEYVKEILIEESNVQPVNSPVTVCGDIHGQFHDLMKLFQTGGHVPETNYIFMGDFVDRGYNSLEVFTILLLLKARYPANITLLRGNHESRQLTQVYGFYDECQRKYGNANAWRYCTDVFDYLTLSAIIDGTVLCVHGGLSPDIRTIDQIRVIERNCEIPHEGPFCDLMWSDPEDIETWAVSPRGAGWLFGSRVTSEFNHINNLDLVCRAHQLVQEGLKYMFQDKGLVTVWSAPNYCYRCGNVASILSFNENMVRYPACWHAGVCVCVCVF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLDQWIAKVKEGQHLLEDELQLLCEYVKEILIEESNVQPVNSPVTVCGDIHGQFHDLMKLFQTGGHVPETNYIFMGDFVDRGYNSLEVFTILLLLKARYPANITLLRGNHESRQLTQVYGFYDECQRKYGNANAWRYCTDVFDYLTLSAIIDGTVLCVHGGLSPDIRTIDQIRVIERNCEIPHEGPFCDLMWSDPEDIETWAVSPRGAGWLFGSRVTSEFNHINNLDLVCRAHQLVQEGLKYMFQDKGLVTVWSAPNYCYRCGNVASILSFNENMVRYPACWHAGVCVCVCVF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phytochrome-associated serine/threonine-protein phosphatase 3 Dephosphorylates phosphorylated phytochromes, with a preference toward Pfr forms. Plays a major role in the photoperiodic control of flowering time in long days by modulating phytochrome signals in flowering time control.confidentQ9LHE7
Phytochrome-associated serine/threonine-protein phosphatase 1 Dephosphorylates phosphorylated phytochromes, with a preference toward Pfr forms. Plays a major role in the photoperiodic control of flowering time in long days by modulating phytochrome signals in flowering time control.confidentQ9SX52
Serine/threonine-protein phosphatase ppe1 Has a role in chromosome segregation. May provide a dynamic connection between kinetochore microtubules and kinetochore chromatin. Negatively regulates mis12.confidentP36614

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.16Phosphoprotein phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FJM, chain A
Confidence level:very confident
Coverage over the Query: 1-287
View the alignment between query and template
View the model in PyMOL