Citrus Sinensis ID: 022667


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290----
MVRAFKMKGQKRKKKRDEKYDREEEEEEKEEVEEEELNDSGKRAKLEKTSQNDNKKGEEDGQEEKDVVVHEMEGIPIAPSDQNTKRPGVIFVLEKASLEVAKVGKSYQILNSDDHSNFLRRNNKNPADYRPDIVHQALLSILDSRLTKAGRLQAVYVRTDKGVLFEVKPHVRLPRTYKRFAGIMLQLLQKLSITAVGKREKLLRVIKNPVTQYLPVNSRKIGFSYSSEKLVKMRNYVASISDDDNLVFVVGAMAHGKIDCDYTDDLIAISGYPLSAARCIARICEALEDKWNLL
cccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccEEEEEccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHccHHHHcccccEEEEEEcccEEEEEcccccccccHHHHHHHHHHHHHHccccccccccccEEEEEcccccccccccCEEEEEccccccccHHHHHHHccccccEEEEEcccccccccccccccEEEECcccccHHHHHHHHHHHHHHHcccc
***************************************************************************************GVIFVLEKASLEVAKVGKSYQILNSDDHSNFLRRNNKNPADYRPDIVHQALLSILDSRLTKAGRLQAVYVRTDKGVLFEVKPHVRLPRTYKRFAGIMLQLLQKLSITAVGKREKLLRVIKNPVTQYLPVNSRKIGFSYSSEKLVKMRNYVASISDDDNLVFVVGAMAHGKIDCDYTDDLIAISGYPLSAARCIARICEALEDKWNLL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRAFKMKGQKRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRAKLEKTSQNDNKKGEEDGQEEKDVVVHEMEGIPIAPSDQNTKRPGVIFVLEKASLEVAKVGKSYQILNSDDHSNFLRRNNKNPADYRPDIVHQALLSILDSRLTKAGRLQAVYVRTDKGVLFEVKPHVRLPRTYKRFAGIMLQLLQKLSITAVGKREKLLRVIKNPVTQYLPVNSRKIGFSYSSEKLVKMRNYVASISDDDNLVFVVGAMAHGKIDCDYTDDLIAISGYPLSAARCIARICEALEDKWNLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ribosomal RNA small subunit methyltransferase NEP1 Involved in 40S ribosomal subunit biogenesis and 18S rRNA processing. Specifically catalyzes the N1-methylation of the pseudouridine corresponding to position 1248 in human 18S rRNA. Thus, appears to be the methyltransferase involved in the biosynthesis of the hypermodified N1-methyl-N3-(3-amino-3-carboxypropyl) pseudouridine (m1acp3-Psi) conserved in eukaryotic 18S rRNA.probableO35130
Ribosomal RNA small subunit methyltransferase nep-1 Involved in 40S ribosomal subunit biogenesis and 18S rRNA processing. Specifically catalyzes the N1-methylation of the pseudouridine corresponding to position 1248 in human 18S rRNA. Thus, appears to be the methyltransferase involved in the biosynthesis of the hypermodified N1-methyl-N3-(3-amino-3-carboxypropyl) pseudouridine (m1acp3-Psi) conserved in eukaryotic 18S rRNA.probableQ9XX15

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OII, chain A
Confidence level:very confident
Coverage over the Query: 81-294
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 2-68
View the alignment between query and template
View the model in PyMOL