BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 022692
(293 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q58720|MOBB_METJA Putative molybdopterin-guanine dinucleotide biosynthesis adapter
protein OS=Methanocaldococcus jannaschii (strain ATCC
43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
GN=mobB PE=3 SV=1
Length = 234
Score = 31.2 bits (69), Expect = 8.7, Method: Compositional matrix adjust.
Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 13/71 (18%)
Query: 84 CGAFCRTYKKVALMNEECFLEQKEEEWSQLILNKGSSDLVD--ILKAVEFELHVQEPFFS 141
CG CRT+ K + + E W +L KG +VD I+ AV F V + S
Sbjct: 158 CGYNCRTFVKAVV--------KGEARWDDCVLAKGIKIIVDGKIIPAVPF---VSKIVGS 206
Query: 142 FIKDGLETVEG 152
IK +ET++G
Sbjct: 207 TIKAMIETLKG 217
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.323 0.137 0.423
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 104,235,526
Number of Sequences: 539616
Number of extensions: 4083578
Number of successful extensions: 12324
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 12322
Number of HSP's gapped (non-prelim): 4
length of query: 293
length of database: 191,569,459
effective HSP length: 116
effective length of query: 177
effective length of database: 128,974,003
effective search space: 22828398531
effective search space used: 22828398531
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 61 (28.1 bits)