BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 022692
         (293 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q58720|MOBB_METJA Putative molybdopterin-guanine dinucleotide biosynthesis adapter
           protein OS=Methanocaldococcus jannaschii (strain ATCC
           43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
           GN=mobB PE=3 SV=1
          Length = 234

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 13/71 (18%)

Query: 84  CGAFCRTYKKVALMNEECFLEQKEEEWSQLILNKGSSDLVD--ILKAVEFELHVQEPFFS 141
           CG  CRT+ K  +        + E  W   +L KG   +VD  I+ AV F   V +   S
Sbjct: 158 CGYNCRTFVKAVV--------KGEARWDDCVLAKGIKIIVDGKIIPAVPF---VSKIVGS 206

Query: 142 FIKDGLETVEG 152
            IK  +ET++G
Sbjct: 207 TIKAMIETLKG 217


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.323    0.137    0.423 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 104,235,526
Number of Sequences: 539616
Number of extensions: 4083578
Number of successful extensions: 12324
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 12322
Number of HSP's gapped (non-prelim): 4
length of query: 293
length of database: 191,569,459
effective HSP length: 116
effective length of query: 177
effective length of database: 128,974,003
effective search space: 22828398531
effective search space used: 22828398531
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 61 (28.1 bits)