Query         022697
Match_columns 293
No_of_seqs    49 out of 51
Neff          2.7 
Searched_HMMs 46136
Date          Fri Mar 29 05:29:44 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/022697.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/022697hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF11571 Med27:  Mediator compl 100.0 7.6E-30 1.7E-34  198.9   6.3   86  179-288     4-90  (90)
  2 KOG3043 Predicted hydrolase re  70.8     4.6  0.0001   38.3   3.4   83  141-224   134-241 (242)
  3 PF14053 DUF4248:  Domain of un  62.3     7.7 0.00017   29.9   2.6   32  198-229    10-41  (69)
  4 KOG1701 Focal adhesion adaptor  51.2     5.4 0.00012   40.8   0.2   12  229-240   335-346 (468)
  5 PF10367 Vps39_2:  Vacuolar sor  50.8     4.2 9.2E-05   30.8  -0.4   13  228-240    78-90  (109)
  6 PF03297 Ribosomal_S25:  S25 ri  34.2      28  0.0006   29.1   1.8   18   74-91     45-62  (105)
  7 PRK09334 30S ribosomal protein  31.1      33 0.00072   27.9   1.8   18   74-91     27-44  (86)
  8 PF06046 Sec6:  Exocyst complex  29.3      18 0.00039   35.7   0.0   47  181-227   130-181 (566)
  9 KOG2272 Focal adhesion protein  22.8      22 0.00047   34.8  -0.7   34  207-240    49-85  (332)
 10 PF10892 DUF2688:  Protein of u  21.9      28 0.00061   27.0  -0.2   15  226-240     8-22  (60)
 11 PF13959 DUF4217:  Domain of un  21.4      97  0.0021   23.1   2.6   24  209-234    17-40  (65)
 12 COG0394 Wzb Protein-tyrosine-p  20.2 2.5E+02  0.0054   23.8   5.2   92  103-202    41-136 (139)

No 1  
>PF11571 Med27:  Mediator complex subunit 27;  InterPro: IPR021627  Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function []. Mediator exists in two major forms in human cells: a smaller form that interacts strongly with pol II and activates transcription, and a large form that does not interact strongly with pol II and does not directly activate transcription. The ubiquitous expression of Med27 mRNA suggests a universal requirement for Med27 in transcriptional initiation. Loss of Crsp34/Med27 decreases amacrine cell number, but increases the number of rod photoreceptor cells []. 
Probab=99.96  E-value=7.6e-30  Score=198.91  Aligned_cols=86  Identities=48%  Similarity=0.790  Sum_probs=77.8

Q ss_pred             ccCCcCcchhhHHhhHHhHHHHhhccc-CCCchhHHHHHHHHHHHhhhhchHhhhHHHHhhhccccccCCCCCccccCCC
Q 022697          179 IHARGSSVYHVFRHITEHAGTALQFFL-GIRTETSLYFLLHWICSYQTLFSKVCSKCGRLLAMDKRLALLLPPVSRPYRH  257 (293)
Q Consensus       179 l~~ws~Sry~VFRKITEHA~~AL~~F~-s~~PetaLrsFLtWL~SYr~LFs~PCkkCgklL~~Ds~~~~~LPPtwRDfR~  257 (293)
                      +++|++|+|+|||++|+||++||+||. ++.|+.+|++||+||+||++||++||++|||+|    ++.++|||+||+++.
T Consensus         4 ~~~~~~S~~~v~~~~t~~a~~al~~~~~~~~~~~~l~~ll~~l~sY~~lfs~pC~~C~klL----~~~~~LPP~~r~~~~   79 (90)
T PF11571_consen    4 VDPWSPSRYKVFRKITEHANTALLHFINSRPPEWDLRSLLDWLSSYRNLFSTPCKKCGKLL----SSKAFLPPVRRPKDF   79 (90)
T ss_pred             cccccchhhhhhhhhhHHHHHHHHHhhhcCCCccHHHHHHHHHHHHhhhccchhhHHHhHh----hhcccCCCeeecccC
Confidence            589999999999999999999988776 799999999999999999999999999999999    233599999998777


Q ss_pred             CCcccccchhhccccccCCCccccccccccC
Q 022697          258 FFPTVTSSAQLISSTNEQSSDVVNAYHIGCF  288 (293)
Q Consensus       258 ~~~~~~~s~~~~~~~~~~~~d~~~AYH~gC~  288 (293)
                      .+                    .+|||++|+
T Consensus        80 ~~--------------------~~ayH~~C~   90 (90)
T PF11571_consen   80 RS--------------------WEAYHEGCR   90 (90)
T ss_pred             CC--------------------CcccCcccC
Confidence            63                    499999995


No 2  
>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only]
Probab=70.80  E-value=4.6  Score=38.28  Aligned_cols=83  Identities=19%  Similarity=0.264  Sum_probs=51.6

Q ss_pred             Eeeeechh-hhhhheeeCCC--CCCCCce----eeEecCCCCCc----cc---------cCCcCcchhhHHhhHHhHHHH
Q 022697          141 VIELLFPS-IFRAIVSLHPV--GTIEPDA----VAFFSPDEGGN----YI---------HARGSSVYHVFRHITEHAGTA  200 (293)
Q Consensus       141 viel~~p~-vFkaiIsl~~a--gS~dpD~----VafFsp~E~g~----yl---------~~ws~Sry~VFRKITEHA~~A  200 (293)
                      ||++..-. -|+|+||+||.  .|-||..    |.|..-.+|-.    -+         ++=..|+.++|-.++ |+..|
T Consensus       134 vv~~~~~~~~f~a~v~~hps~~d~~D~~~vk~Pilfl~ae~D~~~p~~~v~~~ee~lk~~~~~~~~v~~f~g~~-HGf~~  212 (242)
T KOG3043|consen  134 VVTLSAKDPEFDAGVSFHPSFVDSADIANVKAPILFLFAELDEDVPPKDVKAWEEKLKENPAVGSQVKTFSGVG-HGFVA  212 (242)
T ss_pred             EEEeeccchhheeeeEecCCcCChhHHhcCCCCEEEEeecccccCCHHHHHHHHHHHhcCcccceeEEEcCCcc-chhhh
Confidence            56666655 89999999998  7677655    44444433321    11         333337778887775 45444


Q ss_pred             hhcccC-----CCchhHHHHHHHHHHHhh
Q 022697          201 LQFFLG-----IRTETSLYFLLHWICSYQ  224 (293)
Q Consensus       201 L~~F~s-----~~PetaLrsFLtWL~SYr  224 (293)
                      -.+=.+     ..-|.+...|+.||+.|-
T Consensus       213 ~r~~~~~Ped~~~~eea~~~~~~Wf~~y~  241 (242)
T KOG3043|consen  213 RRANISSPEDKKAAEEAYQRFISWFKHYL  241 (242)
T ss_pred             hccCCCChhHHHHHHHHHHHHHHHHHHhh
Confidence            332111     222479999999999984


No 3  
>PF14053 DUF4248:  Domain of unknown function (DUF4248)
Probab=62.33  E-value=7.7  Score=29.92  Aligned_cols=32  Identities=19%  Similarity=0.346  Sum_probs=26.8

Q ss_pred             HHHhhcccCCCchhHHHHHHHHHHHhhhhchH
Q 022697          198 GTALQFFLGIRTETSLYFLLHWICSYQTLFSK  229 (293)
Q Consensus       198 ~~AL~~F~s~~PetaLrsFLtWL~SYr~LFs~  229 (293)
                      .-|+.||-...|..|++.|..||.-...|-.+
T Consensus        10 ELA~lYfP~~~~~sA~r~L~rwI~~~~~L~~~   41 (69)
T PF14053_consen   10 ELAQLYFPDLTPSSAVRKLRRWIRRNPELLEE   41 (69)
T ss_pred             HHHHHHcCCCCHHHHHHHHHHHHHHCHHHHHH
Confidence            34688998889999999999999988777544


No 4  
>KOG1701 consensus Focal adhesion adaptor protein Paxillin and related LIM proteins [Signal transduction mechanisms]
Probab=51.18  E-value=5.4  Score=40.78  Aligned_cols=12  Identities=33%  Similarity=0.844  Sum_probs=9.6

Q ss_pred             HhhhHHHHhhhc
Q 022697          229 KVCSKCGRLLAM  240 (293)
Q Consensus       229 ~PCkkCgklL~~  240 (293)
                      ++|..||+.+.+
T Consensus       335 ekC~~Cg~~I~d  346 (468)
T KOG1701|consen  335 EKCNKCGEPIMD  346 (468)
T ss_pred             HHHhhhhhHHHH
Confidence            689999988764


No 5  
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=50.82  E-value=4.2  Score=30.77  Aligned_cols=13  Identities=46%  Similarity=0.856  Sum_probs=11.1

Q ss_pred             hHhhhHHHHhhhc
Q 022697          228 SKVCSKCGRLLAM  240 (293)
Q Consensus       228 s~PCkkCgklL~~  240 (293)
                      .+.|..|||-|.+
T Consensus        78 ~~~C~vC~k~l~~   90 (109)
T PF10367_consen   78 STKCSVCGKPLGN   90 (109)
T ss_pred             CCCccCcCCcCCC
Confidence            3789999999985


No 6  
>PF03297 Ribosomal_S25:  S25 ribosomal protein;  InterPro: IPR004977 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ].  The S25 ribosomal protein is a component of the 40S ribosomal subunit.; PDB: 2XZM_8 2XZN_8 3O30_Q 3U5G_Z 3IZB_V 3U5C_Z 3O2Z_Q 3IZ6_V.
Probab=34.18  E-value=28  Score=29.08  Aligned_cols=18  Identities=39%  Similarity=0.582  Sum_probs=15.6

Q ss_pred             HHHHHHhhhCCCceeeee
Q 022697           74 DVLMRLEKEVPNLKIFTY   91 (293)
Q Consensus        74 ~vl~~le~~~pn~ki~ty   91 (293)
                      +.+..|++|||++|+.|-
T Consensus        45 ~~~~kl~kEV~~~K~ITp   62 (105)
T PF03297_consen   45 ETYDKLLKEVPKMKLITP   62 (105)
T ss_dssp             HHHHHHHHHCTTSSCECH
T ss_pred             HHHHHHHHHhccCcEeeH
Confidence            567889999999999884


No 7  
>PRK09334 30S ribosomal protein S25e; Provisional
Probab=31.09  E-value=33  Score=27.90  Aligned_cols=18  Identities=44%  Similarity=0.517  Sum_probs=15.5

Q ss_pred             HHHHHHhhhCCCceeeee
Q 022697           74 DVLMRLEKEVPNLKIFTY   91 (293)
Q Consensus        74 ~vl~~le~~~pn~ki~ty   91 (293)
                      +.+.+|.||||++|+.|-
T Consensus        27 ~t~dkl~kEV~~~K~ITp   44 (86)
T PRK09334         27 ELLKRVAKEVKKEKIVTP   44 (86)
T ss_pred             HHHHHHHHHhccCcEEcH
Confidence            467889999999999884


No 8  
>PF06046 Sec6:  Exocyst complex component Sec6;  InterPro: IPR010326 Sec6 is a component of the multiprotein exocyst complex. Sec6 interacts with Sec8, Sec10 and Exo70.These exocyst proteins localise to regions of active exocytosis-at the growing ends of interphase cells and in the medial region of cells undergoing cytokinesis-in an F-actin-dependent and exocytosis- independent manner [].; PDB: 2FJI_2.
Probab=29.31  E-value=18  Score=35.66  Aligned_cols=47  Identities=21%  Similarity=0.318  Sum_probs=0.0

Q ss_pred             CCcCcchhhHHhhHHhHHHHhhcccC-----CCchhHHHHHHHHHHHhhhhc
Q 022697          181 ARGSSVYHVFRHITEHAGTALQFFLG-----IRTETSLYFLLHWICSYQTLF  227 (293)
Q Consensus       181 ~ws~Sry~VFRKITEHA~~AL~~F~s-----~~PetaLrsFLtWL~SYr~LF  227 (293)
                      +=-|..|+||+..+..-+.+|+-+..     ..+...+..++.|++.|.++-
T Consensus       130 ~cfPp~~~I~~~y~~~YH~~l~~~l~~l~~~~l~~~~ll~ll~W~~~Y~~~m  181 (566)
T PF06046_consen  130 PCFPPEYDIFNTYVSMYHNALSDHLQELISPDLEANDLLSLLSWVNTYPSIM  181 (566)
T ss_dssp             ----------------------------------------------------
T ss_pred             ccCCCCChHHHHHHHHHHHHHHHHHHHHccCCCCHHHHhhheechhhChHhh
Confidence            33456788999999988888875443     445579999999999999843


No 9  
>KOG2272 consensus Focal adhesion protein PINCH-1, contains LIM domains [Signal transduction mechanisms; Cytoskeleton]
Probab=22.77  E-value=22  Score=34.83  Aligned_cols=34  Identities=21%  Similarity=0.438  Sum_probs=24.1

Q ss_pred             CCchhHHHHHHHH---HHHhhhhchHhhhHHHHhhhc
Q 022697          207 IRTETSLYFLLHW---ICSYQTLFSKVCSKCGRLLAM  240 (293)
Q Consensus       207 ~~PetaLrsFLtW---L~SYr~LFs~PCkkCgklL~~  240 (293)
                      ..|+...+.|=.-   =|.|+.||.--|-+||.++.-
T Consensus        49 pf~~g~~~efEgRkYCEhDF~~LfaPcC~kC~EFiiG   85 (332)
T KOG2272|consen   49 PFPDGIFYEFEGRKYCEHDFHVLFAPCCGKCGEFIIG   85 (332)
T ss_pred             cCCCceeEEecCcccccccchhhhchhhcccccchhh
Confidence            3455555444322   367899999999999998874


No 10 
>PF10892 DUF2688:  Protein of unknown function (DUF2688);  InterPro: IPR024392 Members of this protein family are annotated as KleB, and may play a role in the regulation of transcription in plasmids.
Probab=21.89  E-value=28  Score=27.03  Aligned_cols=15  Identities=20%  Similarity=0.793  Sum_probs=12.4

Q ss_pred             hchHhhhHHHHhhhc
Q 022697          226 LFSKVCSKCGRLLAM  240 (293)
Q Consensus       226 LFs~PCkkCgklL~~  240 (293)
                      +-+.+|++||+-|.+
T Consensus         8 IV~t~CrRCGk~i~t   22 (60)
T PF10892_consen    8 IVETPCRRCGKSIRT   22 (60)
T ss_pred             eeeehhhhhCccHHH
Confidence            557899999998865


No 11 
>PF13959 DUF4217:  Domain of unknown function (DUF4217)
Probab=21.40  E-value=97  Score=23.06  Aligned_cols=24  Identities=13%  Similarity=0.192  Sum_probs=19.2

Q ss_pred             chhHHHHHHHHHHHhhhhchHhhhHH
Q 022697          209 TETSLYFLLHWICSYQTLFSKVCSKC  234 (293)
Q Consensus       209 PetaLrsFLtWL~SYr~LFs~PCkkC  234 (293)
                      -+.|-+-|.+|+++|.+.  .+|+.+
T Consensus        17 ~~lA~~Af~SyvraY~~~--~~~k~i   40 (65)
T PF13959_consen   17 KELAQKAFVSYVRAYASH--KELKDI   40 (65)
T ss_pred             HHHHHHHHHHHHHHHHHH--hhhhhh
Confidence            347899999999999987  666654


No 12 
>COG0394 Wzb Protein-tyrosine-phosphatase [Signal transduction mechanisms]
Probab=20.24  E-value=2.5e+02  Score=23.79  Aligned_cols=92  Identities=21%  Similarity=0.188  Sum_probs=57.0

Q ss_pred             CCCC-CCCCccchhcccccccCCCCCCCCcccccccceeEeeeechhhhhhheeeCCCCCCCCceeeEecCCCCCccccC
Q 022697          103 LPSS-ANESPLELLKEHNFHSSSKLRPGLQNTVAADKVSVIELLFPSIFRAIVSLHPVGTIEPDAVAFFSPDEGGNYIHA  181 (293)
Q Consensus       103 l~~~-~~~~~~~~sk~~~~~~~~k~r~~~~~~~~~d~vaviel~~p~vFkaiIsl~~agS~dpD~VafFsp~E~g~yl~~  181 (293)
                      .++. .+..-++..+|+++..+. .|+-..+....++.=+|=-+.++-.+-+..+.|.+.       .+-..++|...+|
T Consensus        41 ~~g~~~~~~a~~vl~e~Gid~~~-~~~k~i~~~~~~~~DlIitmd~~~~~~~~~~~p~~~-------~~~~~~~~~v~DP  112 (139)
T COG0394          41 HPGEPPDPRAVEVLAEHGIDISG-HRSKQLTEEDFDEFDLIITMDESNAADLCPLAPGNT-------LLLEYEHWEVPDP  112 (139)
T ss_pred             CCCCCCCHHHHHHHHHcCCCcCC-ccCccCchhhhhhCCEEEEeChHHHhhHhhcCcccc-------ccccccCCCCCCC
Confidence            3444 777888899999999886 444444443333444444444555555555555543       2223344888899


Q ss_pred             CcCc---chhhHHhhHHhHHHHhh
Q 022697          182 RGSS---VYHVFRHITEHAGTALQ  202 (293)
Q Consensus       182 ws~S---ry~VFRKITEHA~~AL~  202 (293)
                      |..|   .-++||.|.+.+..-+.
T Consensus       113 ~~~~~e~~~~~~~~i~~~~~~l~~  136 (139)
T COG0394         113 YYGSGEEFEEVYRLIEDAIKALLK  136 (139)
T ss_pred             CCCchHHHHHHHHHHHHHHHHHHH
Confidence            9887   46788888887665443


Done!