Citrus Sinensis ID: 022708

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290---
MATTQGQQQGTIMDPNALDDIIHRLTEVRFARPGKQVQLSESEIKQLCVASRDIFMRQPNLLELEAPMKICGDVHGQYSDLLRLFEYGGYPPKANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNVRLWKAFTDCFNCLPVAALIDEKILCMHGGLSPDLSHLDQIRNLPRPTAVPDTGLLCDLLWSDPGRDVKGWGMNDRGVSYTFGPDKVSEFLKRHDLDLVCRAHQVVDFPTLSFSIFFLFFWYRRAGKNVPLALATSIMM
cccccccccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccEEEEccccEEEccccccHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHcccccEEECcccccccccccccHHHHHHHHHccHHHHHHHHHHcccccHHEEEcccEEEEccccccccccHHHHHcccccccccccccccccccccccccccccccccccccEEccHHHHHHHHHHccccEEEEcccccccccEEEEEEcccccccccccccEEEEEccccc
****************ALDDIIHRLTEVRFARPGKQVQLSESEIKQLCVASRDIFMRQPNLLELEAPMKICGDVHGQYSDLLRLFEYGGYPPKANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNVRLWKAFTDCFNCLPVAALIDEKILCMHGGLSPDLSHLDQIRNLPRPTAVPDTGLLCDLLWSDPGRDVKGWGMNDRGVSYTFGPDKVSEFLKRHDLDLVCRAHQVVDFPTLSFSIFFLFFWYRRAGKNVPLALATSIMM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATTQGQQQGTIMDPNALDDIIHRLTEVRFARPGKQVQLSESEIKQLCVASRDIFMRQPNLLELEAPMKICGDVHGQYSDLLRLFEYGGYPPKANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNVRLWKAFTDCFNCLPVAALIDEKILCMHGGLSPDLSHLDQIRNLPRPTAVPDTGLLCDLLWSDPGRDVKGWGMNDRGVSYTFGPDKVSEFLKRHDLDLVCRAHQVVDFPTLSFSIFFLFFWYRRAGKNVPLALATSIMM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein phosphatase PP1-beta catalytic subunit Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.probableP61292
Serine/threonine-protein phosphatase beta isoform Required for cell adhesion in non-muscle tissues and in maintenance of muscle attachment. Vital for larval development.probableP48462
Serine/threonine-protein phosphatase PP1-beta catalytic subunit Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.probableP62143

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.16Phosphoprotein phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3E7A, chain A
Confidence level:very confident
Coverage over the Query: 16-279
View the alignment between query and template
View the model in PyMOL