Citrus Sinensis ID: 022713

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290---

MGFDDGCNTGLVLGLGFASAIETTPTNKANNINIVNHQQLQLPKGTCFEPSLSLGLPGEIYPEAATATTKKNSNSIDVNKGYEESAAAGVAEYQILNRQASPHSAVSNSFSSGRVVKRERDLSSEEIEVEKVISSRASDEDEDGVNARKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLHKELQELKALKLAQPLYMHMPAATLTMCPSCERIGGGIADGNSKGPFPMGTKPHCYSPFTNPSAAC

ccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccc

*****GCNTGLVLGLGFASA***********************KGTCFEPSLSLGLPGE***********************************************************************************************KEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLHKELQELKALKLAQPLYMHMPAATLTMCPSCERI********************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGFDDGCNTGLVLGLGFASAIETTPTNKANNINIVNHQQLQLPKGTCFEPSLSLGLPGEIYPEAATATTKKNSNSIDVNKGYEESAAAGVAEYQILNRQASPHSAVSNSFSSGRVVKRERDLSSEEIEVEKVISSRASDEDEDGVNARKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCxxxxxxxxxxxxxxxxxxxxxxxxQPLYMHMPAATLTMCPSCERIGGGIADGNSKGPFPMGTKPHCYSPFTNPSAAC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Homeobox-leucine zipper protein HAT22	Probable transcription factor.	probable	P46604
Homeobox-leucine zipper protein HOX27	Probable transcription factor.	probable	Q6YPD0
Homeobox-leucine zipper protein HOX11	Probable transcription factor.	probable	Q67UE2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NK2, chain P
Confidence level:very confident
Coverage over the Query: 143-209
View the alignment between query and template
View the model in PyMOL

Template: 1HJB, chain A
Confidence level:probable
Coverage over the Query: 198-237
View the alignment between query and template
View the model in PyMOL