Citrus Sinensis ID: 022715


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290---
MQLIIWLLLMIGGFTPTQVRELETDPLFNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMEKSPHSYLAFSGAEEFARQQGVELFDNEYFITEENVGMLKLAKEANSILFDYRIPNGGFETCSAGAAATDSPLQMNGLPISLYAPETVGCVVVDQEGRCAAATSTGGLMNKRTGRIGDSPLIGAGTYASNLCGVSCTGEGEAIIRATLARDVAAVMEYKGLCLQEAVDFVIKERLDEGQAGLIAVSKNGEVACGFNANGMFRGCATEDGFMEVGIWP
ccHHHHHHHHccccHHHHHHHHHHcccccccccccccccccCEEEEEEEEcccccEEEEEEccccccHHHHHHHHHHccccCEEEcHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEcccccccccccccccccccccccccccccEEEEccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccEEEEEEcccccEEEECcccccEEEEECcccCEEEEEcc
*QLIIWLLLMIGGFTPTQVRELETDPLFNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMEKSPHSYLAFSGAEEFARQQGVELFDNEYFITEENVGMLKLAKEANSILFDYRIPNGGF****************NGLPISLYAPETVGCVVVDQEGRCAAATSTGGLMNKRTGRIGDSPLIGAGTYASNLCGVSCTGEGEAIIRATLARDVAAVMEYKGLCLQEAVDFVIKERLDEGQAGLIAVSKNGEVACGFNANGMFRGCATEDGFMEVGIWP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQLIIWLLLMIGGFTPTQVRELETDPLFNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMEKSPHSYLAFSGAEEFARQQGVELFDNEYFITEENVGMLKLAKEANSILFDYRIPNGGFETCSAGAAATDSPLQMNGLPISLYAPETVGCVVVDQEGRCAAATSTGGLMNKRTGRIGDSPLIGAGTYASNLCGVSCTGEGEAIIRATLARDVAAVMEYKGLCLQEAVDFVIKERLDEGQAGLIAVSKNGEVACGFNANGMFRGCATEDGFMEVGIWP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable isoaspartyl peptidase/L-asparaginase 2 Acts in asparagine catabolism and also in the final steps of protein degradation via hydrolysis of a range of isoaspartyl dipeptides.confidentQ8GXG1
Isoaspartyl peptidase/L-asparaginase Acts in asparagine catabolism but also in the final steps of protein degradation via hydrolysis of a range of isoaspartyl dipeptides.probableP30364
Isoaspartyl peptidase/L-asparaginase Acts in asparagine catabolism but also in the final steps of protein degradation via hydrolysis of a range of isoaspartyl dipeptides.probableP50288

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GEZ, chain B
Confidence level:very confident
Coverage over the Query: 163-293
View the alignment between query and template
View the model in PyMOL
Template: 2GEZ, chain A
Confidence level:very confident
Coverage over the Query: 4-122
View the alignment between query and template
View the model in PyMOL
Template: 2A8J, chain A
Confidence level:very confident
Coverage over the Query: 4-102,163-293
View the alignment between query and template
View the model in PyMOL