BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 022723
         (293 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2CXH|A Chain A, Crystal Structure Of Probable Ribosomal Biogenesis Protein
           From Aeropyrum Pernix K1
          Length = 217

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 84  KILLTTSRDPSAPLTQFVKELKFVFPNAQRMNRGGQVISEIIETCRAHEFTDVVLVHEHR 143
           +IL+TTSR PS  +  FVK+L    P A R  RG     E+           +V+V E R
Sbjct: 35  RILVTTSRRPSPRIRSFVKDLSATIPGAFRFTRGHYSXEELAREAIIRGADRIVVVGERR 94

Query: 144 GVPDGLIICHLPFGP 158
           G P G+I  +   GP
Sbjct: 95  GNP-GIIRVYAVEGP 108


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.138    0.401 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,906,540
Number of Sequences: 62578
Number of extensions: 380689
Number of successful extensions: 923
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 918
Number of HSP's gapped (non-prelim): 9
length of query: 293
length of database: 14,973,337
effective HSP length: 98
effective length of query: 195
effective length of database: 8,840,693
effective search space: 1723935135
effective search space used: 1723935135
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)