Citrus Sinensis ID: 022724


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290---
MAAATAMRRRGGGGGMDDDKMVFETTEGVEAITSFDAMGIKDDLLRGIYQYGFEKPSAIQQRAVMPIIKGRDVIAQAQSGTGKTSMIALTVCQTVDTSSREVQALILSPTRELATQTEKVILAIGDFINIQAHACVGGKSVGEDIRKLEHGVHVVSGTPGRVCDMIKRKTLRTRAIKLLVLDESDEMLSRGFKDQIYDVYRYLPPDLQVVLISATLPHEILEMTTKFMTDPVKILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVLLLVLQFP
ccHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHcccccccEEEEEEcccHHHHHHHHHHHHHHHcccccCEEEECccccHHHHHHHHcccccEEEcccHHHHHHccccccccccccEEEEEccccccccccHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHccccEEEEEEccccccccEEEEEEEEccccHHHHHHHHHHHHccccEEEEEEcccccHHHHHHccc
***********************ETTEGVEAITSFDAMGIKDDLLRGIYQYGFEKPSAIQQRAVMPIIKGRDVIAQAQSGTGKTSMIALTVCQTVDTSSREVQALILSPTRELATQTEKVILAIGDFINIQAHACVGGKSVGEDIRKLEHGVHVVSGTPGRVCDMIKRKTLRTRAIKLLVLDESDEMLSRGFKDQIYDVYRYLPPDLQVVLISATLPHEILEMTTKFMTDPVKILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVLLLVLQFP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAATAMRRRGGGGGMDDDKMVFETTEGVEAITSFDAMGIKDDLLRGIYQYGFEKPSAIQQRAVMPIIKGRDVIAQAQSGTGKTSMIALTVCQTVDTSSREVQALILSPTRELATQTEKVILAIGDFINIQAHACVGGKSVGEDIRKLEHGVHVVSGTPGRVCDMIKRKTLRTRAIKLLVLDESDEMLSRGFKDQIYDVYRYLPPDLQVVLISATLPHEILEMTTKFMTDPVKILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVLLLVLQFP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-dependent RNA helicase FAL1 ATP-dependent RNA helicase involved in 40S ribosomal subunit biogenesis. Required for the processing and cleavage of 35S pre-rRNA at sites A0, A1, and A2, leading to mature 18S rRNA.probableP0CQ72
Eukaryotic initiation factor 4A-III ATP-dependent RNA helicase. Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Core components of the EJC, that remains bound to spliced mRNAs throughout all stages of mRNA metabolism, functions to mark the position of the exon-exon junction in the mature mRNA and thereby influences downstream processes of gene expression including mRNA splicing, nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). Constitutes at least part of the platform anchoring other EJC proteins to spliced mRNAs. Its RNA-dependent ATPase and RNA-helicase activities are induced by CASC3, but abolished in presence of the MAGOH/RBM8A heterodimer, thereby trapping the ATP-bound EJC core onto spliced mRNA in a stable conformation. The inhibition of ATPase activity by the MAGOH/RBM8A heterodimer increases the RNA-binding affinity of the EJC. Involved in translational enhancement of spliced mRNAs after formation of the 80S ribosome complex. Binds spliced mRNA in sequence-independent manner, 20-24 nucleotides upstream of mRNA exon-exon junctions. Shows higher affinity for single-stranded RNA in an ATP-bound core EJC complex than after the ATP is hydrolyzed.probableA6M931
DEAD-box ATP-dependent RNA helicase 2 ATP-dependent RNA helicase involved in 40S ribosomal subunit biogenesis. Required for the processing and cleavage of 35S pre-rRNA at sites A0, A1, and A2, leading to mature 18S rRNA.probableQ5VNM3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.4.-Acting on acid anhydrides; involved in cellular and subcellular movement.probable
3.6.4.13RNA helicase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J0S, chain A
Confidence level:very confident
Coverage over the Query: 20-292
View the alignment between query and template
View the model in PyMOL