Citrus Sinensis ID: 022732

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290---
MHPVGSSSSEYAMLGVSVKMKFVFLSLSFFFSLCLFFMWLLLLGLLVQARFFFQQLISGVSYCHAMQVCHRDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYIAPEVLLRHEYDGKIADVWSCGVTLYVMLVGGYPFEDPDEPKDFRKTIQRILSVQYSVPDTNPISQECRDLISRIFVADPAARITIPEIMKHQWFLKNLPADLVDEKTMSSQYEEPDQPMQSVDVIMQIIAEASIPAVGTHGLNCYMTDNLDMDDDDMDDLDSESELDIDSSGEIIYAL
ccccccccccEEEEEEEEcccEEEEEEEccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccCEEcccccccccccccccccccccccccccHHccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHccccEEEECccccccccHHHHHHHHHHHcccccccccHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccEEECc
*HPVGSSSSEYAMLGVSVKMKFVFLSLSFFFSLCLFFMWLLLLGLLVQARFFFQQLISGVSYCHAMQVCHRDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYIAPEVLLRHEYDGKIADVWSCGVTLYVMLVGGYPFEDPDEPKDFRKTIQRILSVQYSVPDTNPISQECRDLISRIFVADPAARITIPEIMKHQWFLKNLPADLV******************VDVIMQIIAEASIPAVGTHGLNCYMTDNL*********LDSESELDIDSSGEIIYAL
xxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHPVGSSSSEYAMLGVSVKMKFVFLSLSFFFSLCLFFMWLLLLGLLVQARFFFQQLISGVSYCHAMQVCHRDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYIAPEVLLRHEYDGKIADVWSCGVTLYVMLVGGYPFEDPDEPKDFRKTIQRILSVQYSVPDTNPISQECRDLISRIFVADPAARITIPEIMKHQWFLKNLPADLVDEKTMSSQYEEPDQPMQSVDVIMQIIAEASIPAVGTHGLNCYMTDNLDMDDDDMDDLDSESELDIDSSGEIIYAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase SRK2I Together with SRK2D, key component and activator of the abscisic acid (ABA) signaling pathway that regulates numerous ABA responses, such as seed germination, Pro accumulation, root growth inhibition, dormancy and seedling growth, and, to a lesser extent, stomatal closure.probableQ39193
Serine/threonine-protein kinase SAPK10 May play a role in signal transduction of hyperosmotic response.probableQ75H77
Serine/threonine-protein kinase SAPK2 May play a role in signal transduction of hyperosmotic response.probableA2YNT8

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UC3, chain A
Confidence level:very confident
Coverage over the Query: 6-96,112-216,235-250
View the alignment between query and template
View the model in PyMOL