Query         022738
Match_columns 293
No_of_seqs    211 out of 1285
Neff          5.8 
Searched_HMMs 46136
Date          Fri Mar 29 05:47:04 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/022738.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/022738hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3882 Tetraspanin family int  99.9 1.4E-23   3E-28  190.1  15.2  163    3-231     2-232 (237)
  2 PF00335 Tetraspannin:  Tetrasp  99.6 8.3E-17 1.8E-21  138.9  -0.4  152    9-226     1-220 (221)
  3 KOG4433 Tweety transmembrane/c  94.2    0.48   1E-05   47.9  10.8   36  127-162   217-252 (526)
  4 PF04906 Tweety:  Tweety;  Inte  90.6    0.79 1.7E-05   45.5   7.2   34  128-161   194-227 (406)
  5 cd03164 CD53_like_LEL Tetraspa  90.3    0.19 4.2E-06   38.1   2.0   30  174-203    48-86  (86)
  6 PF07086 DUF1352:  Protein of u  79.8      13 0.00027   33.5   8.5   43  130-172    81-123 (186)
  7 PF04103 CD20:  CD20-like famil  76.6    0.95 2.1E-05   37.4   0.4   39  126-164    37-75  (150)
  8 PF15345 TMEM51:  Transmembrane  75.6     6.1 0.00013   36.6   5.4   27  121-147    62-88  (233)
  9 PRK10263 DNA translocase FtsK;  64.9 1.1E+02  0.0024   35.3  13.0   16  120-135    75-90  (1355)
 10 cd03158 penumbra_like_LEL Tetr  62.5     5.1 0.00011   32.2   1.8   18  182-199   102-119 (119)
 11 TIGR01571 A_thal_Cys_rich unch  62.5     5.2 0.00011   32.1   1.9   16  262-277    65-80  (104)
 12 PF05640 NKAIN:  Na,K-Atpase In  62.5      24 0.00051   32.1   6.2   47  122-168    35-81  (200)
 13 PF04749 PLAC8:  PLAC8 family;   60.2       6 0.00013   30.9   1.8   17  261-277    68-84  (106)
 14 cd03166 CD63_LEL Tetraspanin,   60.0     4.6 9.9E-05   31.2   1.1   18  182-199    82-99  (99)
 15 cd03163 TM4SF8_like_LEL Tetras  59.7     5.1 0.00011   31.2   1.3   18  182-199    87-104 (105)
 16 cd03154 TM4SF3_like_LEL Tetras  59.7     6.5 0.00014   30.3   1.9   18  182-199    83-100 (100)
 17 PF10177 DUF2371:  Uncharacteri  59.6      15 0.00032   31.6   4.2   27   10-36     38-64  (141)
 18 cd03161 TM4SF2_6_like_LEL Tetr  59.0       6 0.00013   30.6   1.6   18  182-199    87-104 (104)
 19 cd03167 oculospanin_like_LEL T  57.9     6.4 0.00014   31.9   1.7   18  182-199   103-120 (120)
 20 cd07912 Tweety_N N-terminal do  57.6      29 0.00062   34.9   6.5   39  125-163   214-252 (418)
 21 cd03160 CD37_CD82_like_LEL Tet  56.7     4.6  0.0001   32.2   0.6   18  182-199    99-116 (117)
 22 PRK12585 putative monovalent c  56.5      88  0.0019   28.4   8.7   28   14-41      5-32  (197)
 23 KOG3357 Uncharacterized conser  55.8     8.5 0.00018   32.8   2.1   26  247-272    11-37  (167)
 24 PF13903 Claudin_2:  PMP-22/EMP  54.9      67  0.0015   26.5   7.5   30  122-151    73-103 (172)
 25 cd03165 NET-5_like_LEL Tetrasp  54.9     5.8 0.00013   30.4   0.9   18  182-199    81-98  (98)
 26 cd03159 TM4SF9_like_LEL Tetras  54.5     6.7 0.00014   31.6   1.2   18  182-199   104-121 (121)
 27 cd03156 uroplakin_I_like_LEL T  51.1     8.9 0.00019   29.9   1.4   18  182-199    97-114 (114)
 28 PF08694 UFC1:  Ubiquitin-fold   49.6      11 0.00025   32.5   1.9   25  248-272     9-34  (161)
 29 cd03152 CD9_LEL Tetraspanin, e  48.0      11 0.00024   28.3   1.5   18  182-199    67-84  (84)
 30 cd03127 tetraspanin_LEL Tetras  47.2      11 0.00024   27.8   1.3   18  182-199    73-90  (90)
 31 cd03155 CD151_like_LEL Tetrasp  45.7      15 0.00033   28.7   2.0   18  182-199    91-110 (110)
 32 PF05915 DUF872:  Eukaryotic pr  44.3      57  0.0012   26.9   5.3   24   15-38     44-67  (115)
 33 PF06724 DUF1206:  Domain of Un  43.9      25 0.00054   26.1   2.8   21   18-38     47-67  (73)
 34 PF01601 Corona_S2:  Coronaviru  42.7     8.2 0.00018   40.3   0.0   28  115-142   545-581 (610)
 35 cd03162 peripherin_like_LEL Te  41.9      13 0.00029   31.8   1.2   25  175-199   119-143 (143)
 36 PF05835 Synaphin:  Synaphin pr  40.5      15 0.00031   31.6   1.2   18  261-278    62-79  (139)
 37 PF10176 DUF2370:  Protein of u  38.4      32 0.00069   32.0   3.2   33  114-146   191-223 (233)
 38 PF15050 SCIMP:  SCIMP protein   37.7      64  0.0014   27.2   4.5   33  193-226     2-34  (133)
 39 PF05478 Prominin:  Prominin;    36.0      17 0.00037   39.2   1.2   24  149-172   139-162 (806)
 40 PF01988 VIT1:  VIT family;  In  35.3      58  0.0013   29.2   4.3   22  258-279   108-129 (213)
 41 KOG3950 Gamma/delta sarcoglyca  35.0      36 0.00079   32.0   2.9   27  146-172    34-60  (292)
 42 PF12273 RCR:  Chitin synthesis  31.8      39 0.00084   28.0   2.4   23  203-225     1-23  (130)
 43 cd02432 Nodulin-21_like_1 Nodu  30.6      81  0.0018   28.7   4.5   21  259-279   114-134 (218)
 44 PF04156 IncA:  IncA protein;    30.3      79  0.0017   27.4   4.2   22   15-36      5-26  (191)
 45 cd02434 Nodulin-21_like_3 Nodu  29.9      67  0.0015   29.3   3.8   21  257-277   108-129 (225)
 46 PRK07375 putative monovalent c  29.7 3.1E+02  0.0066   22.3   8.5   17  124-140     6-22  (112)
 47 cd03157 TM4SF12_like_LEL Tetra  29.1      36 0.00078   27.2   1.7   17  182-198    86-102 (103)
 48 KOG1314 DHHC-type Zn-finger pr  29.0 3.3E+02  0.0073   27.1   8.5   64  204-272   192-261 (414)
 49 KOG1362 Choline transporter-li  28.1 6.9E+02   0.015   26.3  11.2   44  184-227   209-252 (577)
 50 PRK11901 hypothetical protein;  27.7      53  0.0011   32.0   2.8   23  121-143    37-59  (327)
 51 PF13706 PepSY_TM_3:  PepSY-ass  24.2 1.1E+02  0.0023   20.0   3.0   22  122-143    11-32  (37)
 52 PF04156 IncA:  IncA protein;    23.9 2.3E+02   0.005   24.5   6.0   21  122-142    10-30  (191)
 53 PF07423 DUF1510:  Protein of u  23.8      71  0.0015   29.4   2.8   26   13-38     12-37  (217)
 54 PF13908 Shisa:  Wnt and FGF in  23.8      38 0.00082   29.5   1.0   22  122-143    78-99  (179)
 55 PF04790 Sarcoglycan_1:  Sarcog  23.5      73  0.0016   30.0   2.9   32  141-172     6-37  (264)
 56 PF09323 DUF1980:  Domain of un  22.8 3.9E+02  0.0084   23.2   7.2   45  117-161    29-86  (182)
 57 PF13314 DUF4083:  Domain of un  21.9 2.2E+02  0.0047   20.9   4.4   33  209-241    13-45  (58)
 58 PRK12585 putative monovalent c  21.5      92   0.002   28.3   3.0   22  118-139     7-28  (197)
 59 PF06341 DUF1056:  Protein of u  20.9 2.1E+02  0.0046   21.3   4.3   30    8-37      5-34  (63)
 60 PF10724 DUF2516:  Protein of u  20.1 4.5E+02  0.0098   21.2   6.4   31   11-41      2-32  (100)

No 1  
>KOG3882 consensus Tetraspanin family integral membrane protein [General function prediction only]
Probab=99.91  E-value=1.4e-23  Score=190.12  Aligned_cols=163  Identities=26%  Similarity=0.442  Sum_probs=136.1

Q ss_pred             ccccchhHHHHHHHHHHHHHHHHHHHHHHHHhhhhccCCccCCCCCCCCCCCCCCCCCcccccccccccccccccccccc
Q 022738            3 RNCCHISFAFILKFLNFLQGFIGVSIILYSIWMLDQWNHHVPVPPLPPLAPTPDTSVSSSSLSLFLNSDTTQSRVLSHDH   82 (293)
Q Consensus         3 ~~~C~~~lk~lL~~lN~l~~l~Gl~lI~~giwml~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l   82 (293)
                      .++|..|+|++++++|+++|++|++++++|+|++.+......                                     +
T Consensus         2 ~~~~~~~~K~~lf~~N~~~~l~G~~ll~~giw~~~~~~~~~~-------------------------------------~   44 (237)
T KOG3882|consen    2 MSCGSSCLKYLLFLLNLLFWLLGLLLLAVGIWLLADKGFLSS-------------------------------------L   44 (237)
T ss_pred             CCcccchHHHHHHHHHHHHHHHHHHHHHhhhheeEeccchhh-------------------------------------c
Confidence            678999999999999999999999999999999887665211                                     0


Q ss_pred             ccccccCCCcccccccccCCCCCCcccCCCCCCcchhhhHHHhhhHHHHHHHHHHHHHHhhcccchhHHHHHHHHHHHHH
Q 022738           83 RRLTTSTGPLDVMVSGFDDVSGLGFDFNSFELPAPWFIYSFMGVGILVCCIALIGCIAAEAISGCCLCFYAILKIILFLL  162 (293)
Q Consensus        83 ~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~l~~~wfIY~~i~vG~i~~iis~~GcigA~~~n~c~L~~Y~vll~lLill  162 (293)
                      .     .                   . . .+..+|   +++++|+++++++++||+||.+||+|+|.+|++++++++++
T Consensus        45 ~-----~-------------------~-~-~~~~~~---ili~~G~v~~~v~flGc~Ga~~es~~lL~~y~~~l~l~~i~   95 (237)
T KOG3882|consen   45 L-----E-------------------S-D-FLVPAY---ILIAVGGVVFLVGFLGCCGALRESRCLLLSYFILLLLLFIA   95 (237)
T ss_pred             c-----c-------------------c-c-hhcchh---hhhhhhHHHHHHHHhhhhhhHhhhHHHHHHHHHHHHHHHHH
Confidence            0     0                   0 0 122334   89999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhcc-----------------------c----------------------CCCCCC----CC------------
Q 022738          163 EAALVAFIAI-----------------------D----------------------RRWEKD----LP------------  181 (293)
Q Consensus       163 Eia~~a~i~~-----------------------n----------------------~dW~~~----iP------------  181 (293)
                      |++++++.+.                       |                      .||.+.    +|            
T Consensus        96 e~~~~i~~~~~~~~l~~~~~~~~~~~~~~~y~~~~~~~~~~d~~Q~~~~CCG~~~~~~~~~~~~~~vP~SCC~~~~~~~~  175 (237)
T KOG3882|consen   96 ELAAGILAFVFRDSLRDELEEQLLKSIWNNYSSDPDLGEAWDKLQRELKCCGVNGYSDYFNCSSNNVPPSCCKRTRRQKF  175 (237)
T ss_pred             HHHHHHHhheeHHHHHHHHHHHHHHHHHHHhCCCccHHHHHHHHHHhccCCcCCCchHHhcCCCCCCCcccCCCcccccc
Confidence            9999966552                       0                      123211    55            


Q ss_pred             -------CCCCCchHHHHHHHHhhchhHHHHHHHHHHHHHHHHHHHHHHHHhhcccc
Q 022738          182 -------FDPTGELDSLRSFIEDNVDICKWVGITVVIVQALSLLLAIILRAMVSTRR  231 (293)
Q Consensus       182 -------~y~tGC~~~l~~~l~~n~~ii~~v~l~v~iiQilgillA~~L~~~i~~~~  231 (293)
                             .|++||.+++.+|+++|+.++++++++++++|++++++|++|...+++++
T Consensus       176 ~~~~~~~~~~~GC~~~~~~~~~~~~~~i~~~~~~i~~~~~~~~~~a~~l~~~i~~~~  232 (237)
T KOG3882|consen  176 PQDVPDNIYTEGCLEKLSSWLESNLLIIGGVGLGIAVLELLGMILACCLANAIRNQR  232 (237)
T ss_pred             cccchhhhhccccHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence                   48899999999999999999999999999999999999999998876544


No 2  
>PF00335 Tetraspannin:  Tetraspanin family RDS_ROM1 subfamily;  InterPro: IPR018499 A number of eukaryotic CD antigens have been shown to be related []. CD9 (also called DRAP-27, MRP-1 or p24) upregulates HB-EGF activity as a receptor for diphtheria toxin as well as its juxtacrine activity. CD9 mAbs modulate cell adhesion and migration and trigger platelet activation that is blocked by mAbs directed to the platelet Fc receptor CD32. In mice, CD9 mAb KMC8.8 has been shown to inhibit the production of myeloid cells in vitro and has a costimulatory activity for T cells. CD9 is a type III membrane protein, with four putative transmembrane domains.  CD37 (or gp52-40) is involved in signal transduction and serves as a stable marker for malignancies derived from mature B cells, like B-CLL, HCL, and all types of B-NHL.  CD63 transfection reduced melanoma cell motility on fibronectin, collagen and laminin, and reduced the growth and metastasis of melanoma cells in nude mice []. CD63 has been used as a marker for late endosomes and for primary melanomas.  These proteins are all type II membrane proteins: they contain an N-terminal transmembrane (TM) domain, which acts both as a signal sequence and a membrane anchor, and 3 additional TM regions (hence the name 'TM4'). The sequences contain a number of conserved cysteine residues. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0016021 integral to membrane; PDB: 1IV5_A 1G8Q_A.
Probab=99.60  E-value=8.3e-17  Score=138.86  Aligned_cols=152  Identities=28%  Similarity=0.462  Sum_probs=15.5

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHhhhhccCCccCCCCCCCCCCCCCCCCCcccccccccccccccccccccccccccc
Q 022738            9 SFAFILKFLNFLQGFIGVSIILYSIWMLDQWNHHVPVPPLPPLAPTPDTSVSSSSLSLFLNSDTTQSRVLSHDHRRLTTS   88 (293)
Q Consensus         9 ~lk~lL~~lN~l~~l~Gl~lI~~giwml~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~   88 (293)
                      |+|+++.++|+++++.|++++++|+|+...... ..   .                                ..      
T Consensus         1 c~k~~l~~~n~l~~l~g~~li~~g~~~~~~~~~-~~---~--------------------------------~~------   38 (221)
T PF00335_consen    1 CLKYILFFLNVLFLLLGLALIGVGIWLLVNNQY-LS---E--------------------------------FS------   38 (221)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             ChhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhh-cc---c--------------------------------cc------
Confidence            689999999999999999999999999421111 10   0                                00      


Q ss_pred             CCCcccccccccCCCCCCcccCCCCCCcchhhhHHHhhhHHHHHHHHHHHHHHhhcccchhHHHHHHHHHHHHHHHHHHH
Q 022738           89 TGPLDVMVSGFDDVSGLGFDFNSFELPAPWFIYSFMGVGILVCCIALIGCIAAEAISGCCLCFYAILKIILFLLEAALVA  168 (293)
Q Consensus        89 ~~~~~~~~~~~~g~~~~~~~~~~~~l~~~wfIY~~i~vG~i~~iis~~GcigA~~~n~c~L~~Y~vll~lLillEia~~a  168 (293)
                                           .......   +++++.+|+++++++++||+|+.++|+|+|..|.+++++++++|++++.
T Consensus        39 ---------------------~~~~~~~---~~~~i~~G~~~~~~~~~G~~~~~~~~~~~l~~y~~~~~~~~v~~~~~~i   94 (221)
T PF00335_consen   39 ---------------------SSFISYV---IIILIFIGIFILIISFLGCIGACRKNRCLLIIYIILLILLFVLELVVGI   94 (221)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             ---------------------ccchhHH---HHHHHHHHHHHHHHHHHHHHHHhhcCcccccccccchhhHHHHHHHHHH
Confidence                                 0000111   2367779999999999999999999999999999999999999999985


Q ss_pred             hhcc--c-------------------------------------------CCCCCC-----------------------C
Q 022738          169 FIAI--D-------------------------------------------RRWEKD-----------------------L  180 (293)
Q Consensus       169 ~i~~--n-------------------------------------------~dW~~~-----------------------i  180 (293)
                      +.+.  +                                           +||.+.                       -
T Consensus        95 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iq~~~~CCG~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~  174 (221)
T PF00335_consen   95 VAFSYRDQLNSSLKDGLSLRCMKSYNSNESFSEAWDNIQEKFECCGVNSPDDWFTSKWSSCSSPDSCPDCQCPDDCSSEN  174 (221)
T ss_dssp             -----HHHHHHHHHHHHHHHHHHSSTT-CHHHHHHHHHHHHHT--SSTTCHHHHHHHHHT---------TCS-TTCCCCH
T ss_pred             hhhhccccccccccccccchhhhccccccchhhheecccccccccCCCCCcccccccccccccccccccccccccccccc
Confidence            4433  0                                           112100                       1


Q ss_pred             CCCCCCchHHHHHHHHhhchhHHHHHHHHHHHHHHHHHHHHHHHHh
Q 022738          181 PFDPTGELDSLRSFIEDNVDICKWVGITVVIVQALSLLLAIILRAM  226 (293)
Q Consensus       181 P~y~tGC~~~l~~~l~~n~~ii~~v~l~v~iiQilgillA~~L~~~  226 (293)
                      +.+.+||.+++.++++++...+.+++++++++|++++++|++|.+.
T Consensus       175 ~~~~~gC~~~l~~~~~~~~~~~~~~~~~~~~l~~~~~~~a~~l~~~  220 (221)
T PF00335_consen  175 SIYTRGCYDKLREYLRSYLKYIGIVSLAILVLQLIGIILACCLCRH  220 (221)
T ss_dssp             CCTST-HHHHHHHHHCT-----------------------------
T ss_pred             cccCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence            1689999999999999999999999999999999999999998753


No 3  
>KOG4433 consensus Tweety transmembrane/cell surface protein [General function prediction only]
Probab=94.15  E-value=0.48  Score=47.93  Aligned_cols=36  Identities=14%  Similarity=0.341  Sum_probs=29.1

Q ss_pred             hHHHHHHHHHHHHHHhhcccchhHHHHHHHHHHHHH
Q 022738          127 GILVCCIALIGCIAAEAISGCCLCFYAILKIILFLL  162 (293)
Q Consensus       127 G~i~~iis~~GcigA~~~n~c~L~~Y~vll~lLill  162 (293)
                      =++.+++.+++++|-+|+|||.|.+|++.=++.+++
T Consensus       217 L~l~LvvC~v~vlglak~Skc~li~fsv~Gll~lvi  252 (526)
T KOG4433|consen  217 LTLLLVVCLVLVLGLAKRSKCLLIVFSVCGLLALVI  252 (526)
T ss_pred             HHHHHHHHHHHHHHHHHhcchhhhHHHHHHHHHHHH
Confidence            357788888999999999999999998765555544


No 4  
>PF04906 Tweety:  Tweety;  InterPro: IPR006990 None of the members of the tweety (tty) family have been functionally characterised. However, they are considered to be transmembrane proteins with five potential membrane-spanning regions. A number of potential functions have been suggested on the basis of homology to the yeast FTR1 and FTH1 iron transporter proteins and the mammalian neurotensin receptors 1 and 2 in that they have a similar hydrophobicity profiles although there is no detectable sequence homology to the tweety-related proteins. It has been proposed that the tweety-related proteins could be involved in transport of iron or other divalent cations or alternatively that they may be membrane-bound receptors [].
Probab=90.65  E-value=0.79  Score=45.53  Aligned_cols=34  Identities=26%  Similarity=0.531  Sum_probs=25.2

Q ss_pred             HHHHHHHHHHHHHHhhcccchhHHHHHHHHHHHH
Q 022738          128 ILVCCIALIGCIAAEAISGCCLCFYAILKIILFL  161 (293)
Q Consensus       128 ~i~~iis~~GcigA~~~n~c~L~~Y~vll~lLil  161 (293)
                      ++.+++.++|++|..+++||.+..++++-++.++
T Consensus       194 ~l~l~icl~~l~glar~Sk~~li~~~v~gll~lv  227 (406)
T PF04906_consen  194 ILDLVICLLGLLGLARQSKCLLIVFSVLGLLALV  227 (406)
T ss_pred             HHHHHHHHHHHHHHHhcCcceEEEeeeccHHHHH
Confidence            4666777888899999999999876665444333


No 5  
>cd03164 CD53_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), CD53_Like family. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". CD53 is a tetraspanin of the lymphoid-myeloid lineage and has been implicated in apoptosis protection. It associates with integrin alpha4beta1. Some of the cellular responses modulated by CD53 may be mediated by JNK activation and/or via the AKT pathway.
Probab=90.26  E-value=0.19  Score=38.14  Aligned_cols=30  Identities=20%  Similarity=0.493  Sum_probs=24.0

Q ss_pred             CCCCCCCC---------CCCCCchHHHHHHHHhhchhHH
Q 022738          174 RRWEKDLP---------FDPTGELDSLRSFIEDNVDICK  203 (293)
Q Consensus       174 ~dW~~~iP---------~y~tGC~~~l~~~l~~n~~ii~  203 (293)
                      +||.+.+|         .|++||.+++.+|+++|+.+++
T Consensus        48 ~Dw~~~vP~SCC~~~~~~~~~GC~~~~~~~~~~~~~iig   86 (86)
T cd03164          48 TDWGSGVPSSCCSSDTEYKVEGCYKKLKNWFESNFLYTG   86 (86)
T ss_pred             hhhCCCCChhhcCCCCccccccHHHHHHHHHHHHHHHhC
Confidence            56655555         5889999999999999988753


No 6  
>PF07086 DUF1352:  Protein of unknown function (DUF1352);  InterPro: IPR009787 This family consists of several hypothetical eukaryotic proteins of around 190 residues in length. The function of this family is unknown.
Probab=79.79  E-value=13  Score=33.45  Aligned_cols=43  Identities=19%  Similarity=0.112  Sum_probs=28.3

Q ss_pred             HHHHHHHHHHHHhhcccchhHHHHHHHHHHHHHHHHHHHhhcc
Q 022738          130 VCCIALIGCIAAEAISGCCLCFYAILKIILFLLEAALVAFIAI  172 (293)
Q Consensus       130 ~~iis~~GcigA~~~n~c~L~~Y~vll~lLillEia~~a~i~~  172 (293)
                      -++.+++|-.|-.+.|.-.|..|++-.+++-++=+..++...+
T Consensus        81 S~ip~~~G~~s~~rN~i~~l~~y~~~~~~~gl~pl~~g~~~~~  123 (186)
T PF07086_consen   81 SLIPSLLGLLSLRRNNISLLRLYMIGSSLFGLLPLIYGAMYYF  123 (186)
T ss_pred             HHHHHHHHHHhcccchHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3445667777777778888888887776665555555544333


No 7  
>PF04103 CD20:  CD20-like family;  InterPro: IPR007237  This family includes the CD20 protein and the beta subunit of the high affinity receptor for IgE Fc. The high affinity receptor for IgE is a tetrameric structure consisting of a single IgE-binding alpha subunit, a single beta subunit, and two disulphide-linked gamma subunits. The alpha subunit of Fc epsilon RI and most Fc receptors are homologous members of the Ig superfamily. By contrast, the beta and gamma subunits from Fc epsilon RI are not homologous to the Ig superfamily. Both molecules have four putative transmembrane segments and a probably topology where both amino- and carboxy termini protrude into the cytoplasm []. This family also includes LR8 like proteins from humans, mice and rats. The function of the human LR8 protein is unknown although it is known to be strongly expressed in the lung fibroblasts []. This family also includes sarcospan is a transmembrane component of dystrophin-associated glycoprotein. Loss of the sarcoglycan complex and sarcospan alone is sufficient to cause muscular dystrophy. The role of the sarcoglycan complex and sarcospan is thought to be to strengthen the dystrophin axis connecting the basement membrane with the cytoskeleton []. ; GO: 0016021 integral to membrane; PDB: 2OSL_Q 3BKY_P 3PP4_P.
Probab=76.58  E-value=0.95  Score=37.38  Aligned_cols=39  Identities=21%  Similarity=0.325  Sum_probs=0.0

Q ss_pred             hhHHHHHHHHHHHHHHhhcccchhHHHHHHHHHHHHHHH
Q 022738          126 VGILVCCIALIGCIAAEAISGCCLCFYAILKIILFLLEA  164 (293)
Q Consensus       126 vG~i~~iis~~GcigA~~~n~c~L~~Y~vll~lLillEi  164 (293)
                      .|+..++.|.+|..+..+.++|++..+.++-++-++.-+
T Consensus        37 ~G~~fiisG~l~i~s~k~~~~~lv~~~l~lsi~s~~~a~   75 (150)
T PF04103_consen   37 GGIFFIISGILGIASEKKPTKCLVIASLVLSIVSALLAL   75 (150)
T ss_dssp             ---------------------------------------
T ss_pred             HHHHHHhhHHHHHHHhcCCcccchHHHHHHHHHHHHHHH
Confidence            488888899999888888889999888877666555433


No 8  
>PF15345 TMEM51:  Transmembrane protein 51
Probab=75.57  E-value=6.1  Score=36.59  Aligned_cols=27  Identities=15%  Similarity=0.277  Sum_probs=20.4

Q ss_pred             hHHHhhhHHHHHHHHHHHHHHhhcccc
Q 022738          121 YSFMGVGILVCCIALIGCIAAEAISGC  147 (293)
Q Consensus       121 Y~~i~vG~i~~iis~~GcigA~~~n~c  147 (293)
                      |+++|+|++++++++|=++=-.++++-
T Consensus        62 yVLVG~Gv~LLLLSICL~IR~KRr~rq   88 (233)
T PF15345_consen   62 YVLVGSGVALLLLSICLSIRDKRRRRQ   88 (233)
T ss_pred             EehhhHHHHHHHHHHHHHHHHHHHHhh
Confidence            699999999999999655555555443


No 9  
>PRK10263 DNA translocase FtsK; Provisional
Probab=64.95  E-value=1.1e+02  Score=35.31  Aligned_cols=16  Identities=13%  Similarity=0.299  Sum_probs=9.7

Q ss_pred             hhHHHhhhHHHHHHHH
Q 022738          120 IYSFMGVGILVCCIAL  135 (293)
Q Consensus       120 IY~~i~vG~i~~iis~  135 (293)
                      .+.++|++.+++.+-+
T Consensus        75 L~~LFGl~AYLLP~LL   90 (1355)
T PRK10263         75 LFFIFGVMAYTIPVII   90 (1355)
T ss_pred             HHHHHhHHHHHHHHHH
Confidence            3456777777665533


No 10 
>cd03158 penumbra_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), penumbra_like family. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". Human Penumbra exhibits growth-suppressive activity in vitro and has been associated with myeloid malignancies.
Probab=62.54  E-value=5.1  Score=32.22  Aligned_cols=18  Identities=33%  Similarity=0.547  Sum_probs=16.5

Q ss_pred             CCCCCchHHHHHHHHhhc
Q 022738          182 FDPTGELDSLRSFIEDNV  199 (293)
Q Consensus       182 ~y~tGC~~~l~~~l~~n~  199 (293)
                      +|++||++++.+|+++|+
T Consensus       102 i~~~GC~~~i~~~~~~n~  119 (119)
T cd03158         102 IYTRGCIDAVVLWIEDNL  119 (119)
T ss_pred             ccccchHHHHHHHHHhhC
Confidence            789999999999999984


No 11 
>TIGR01571 A_thal_Cys_rich uncharacterized Cys-rich domain. This model describes an uncharacterized domain of about 100 residues. It is common in plants but found also in Homo sapiens, Dictyostelium, and Leishmania; at least 12 distinct members are found in Arabidopsis. Most members of this family contain more than 10 per cent Cys, but no Cys residue is invariant across the family.
Probab=62.49  E-value=5.2  Score=32.13  Aligned_cols=16  Identities=38%  Similarity=0.783  Sum_probs=13.1

Q ss_pred             hHHHHHHHhhCCCCCC
Q 022738          262 IWSSRIREKYGLNGGG  277 (293)
Q Consensus       262 ~ws~rmrekygl~~~~  277 (293)
                      ..+++||+|||+..|.
T Consensus        65 ~~R~~~R~ry~i~gs~   80 (104)
T TIGR01571        65 FIRIKLREKYGIQGAP   80 (104)
T ss_pred             HHHHHHHHHhCCCCCC
Confidence            4478999999998754


No 12 
>PF05640 NKAIN:  Na,K-Atpase Interacting protein;  InterPro: IPR008516 NKAIN (Na,K-Atpase INteracting) proteins are a family of evolutionary conserved transmembrane proteins that localise to neurons, that are critical for neuronal function, and that interact with the beta subunits, beta1 in vertebrates and beta in Drosophila, of Na,K-ATPase. NKAINs have highly conserved trans-membrane domains but otherwise no other characterised domains. NKAINs may function as subunits of pore or channel structures in neurons or they may affect the function of other membrane proteins. They are likely to function within the membrane bilayer [].
Probab=62.47  E-value=24  Score=32.09  Aligned_cols=47  Identities=11%  Similarity=0.167  Sum_probs=32.2

Q ss_pred             HHHhhhHHHHHHHHHHHHHHhhcccchhHHHHHHHHHHHHHHHHHHH
Q 022738          122 SFMGVGILVCCIALIGCIAAEAISGCCLCFYAILKIILFLLEAALVA  168 (293)
Q Consensus       122 ~~i~vG~i~~iis~~GcigA~~~n~c~L~~Y~vll~lLillEia~~a  168 (293)
                      .-|.+-.+-.++-++|..||..-++..+..|.+-..+-+..-+-+..
T Consensus        35 aPIl~NF~hIi~vIlGlFG~~QyR~ryi~~Y~vW~~~Wv~wNvfiic   81 (200)
T PF05640_consen   35 APILANFLHIIFVILGLFGAIQYRPRYIIVYAVWTALWVTWNVFIIC   81 (200)
T ss_pred             HHHHHHHHHHHHHHHHHhhheeecchHHHHHHHHHHHHHHHhHHHHH
Confidence            33444445555567788899999999999999877665555444443


No 13 
>PF04749 PLAC8:  PLAC8 family;  InterPro: IPR006461  This group of sequences are described by a region of about 170 amino acids. These proteins have highly divergent N-terminal regions rich in low complexity sequence. PSI-BLAST reveals no clear similarity to any characterised protein. It is common in plants but found also in Homo sapiens (Human), Dictyostelium, and Leishmania; at least 12 distinct members are found in Arabidopsis. Most members of this family contain more than 10 per cent Cys, but no Cys residue is invariant across the family.
Probab=60.16  E-value=6  Score=30.89  Aligned_cols=17  Identities=35%  Similarity=0.661  Sum_probs=13.7

Q ss_pred             hhHHHHHHHhhCCCCCC
Q 022738          261 DIWSSRIREKYGLNGGG  277 (293)
Q Consensus       261 d~ws~rmrekygl~~~~  277 (293)
                      -..|.++|||||++.+.
T Consensus        68 ~~~R~~iR~ry~I~g~~   84 (106)
T PF04749_consen   68 CSLRQQIRERYGIQGSC   84 (106)
T ss_pred             hhHHHHHHHHhCCCCCC
Confidence            55688999999998753


No 14 
>cd03166 CD63_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), CD63 family. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". CD63 is present in platelets, neutrophils, and endothelial cells, amongst others. In platelets it associates with the integrin alphaIIBbeta3 and may modulate alphaIIbbeta3-dependent cytoskeletal reorganization.
Probab=60.01  E-value=4.6  Score=31.16  Aligned_cols=18  Identities=11%  Similarity=0.429  Sum_probs=16.2

Q ss_pred             CCCCCchHHHHHHHHhhc
Q 022738          182 FDPTGELDSLRSFIEDNV  199 (293)
Q Consensus       182 ~y~tGC~~~l~~~l~~n~  199 (293)
                      .|.+||++++.+|+++|+
T Consensus        82 ~y~~GC~~~~~~~~~~~~   99 (99)
T cd03166          82 IHLEGCVTKIEGWLKKNI   99 (99)
T ss_pred             hHHhcCHHHHHHHHHHhC
Confidence            688899999999999874


No 15 
>cd03163 TM4SF8_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), TM4SF8_like subfamily. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". This subfamily contaions transmembrane 4 superfamily 8 (TM4SF8) or Tspan-3 and related proteins. Tspan-3 has been reported to form a complex with integrin beta1 and OSP/claudin-11, which may be involved in oligodendrocyte proliferation and migration.
Probab=59.69  E-value=5.1  Score=31.22  Aligned_cols=18  Identities=11%  Similarity=0.093  Sum_probs=16.5

Q ss_pred             CCCCCchHHHHHHHHhhc
Q 022738          182 FDPTGELDSLRSFIEDNV  199 (293)
Q Consensus       182 ~y~tGC~~~l~~~l~~n~  199 (293)
                      +|++||++++.+|+++|+
T Consensus        87 i~~~GC~~~~~~~~~~~~  104 (105)
T cd03163          87 LYQEGCEAKLVKKLQEVM  104 (105)
T ss_pred             hhhhccHHHHHHHHHHHh
Confidence            588999999999999986


No 16 
>cd03154 TM4SF3_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), TM4SF3_like subfamily. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". This subfamily contaions transmembrane 4 superfamily 3 (TM4SF3) or D6.1a and related proteins. D6.1a associates with alpha6beta4 integrin and supports cell motility, it has been ascribed a role in tumor progression and metastasis.
Probab=59.66  E-value=6.5  Score=30.34  Aligned_cols=18  Identities=11%  Similarity=0.344  Sum_probs=16.2

Q ss_pred             CCCCCchHHHHHHHHhhc
Q 022738          182 FDPTGELDSLRSFIEDNV  199 (293)
Q Consensus       182 ~y~tGC~~~l~~~l~~n~  199 (293)
                      .|++||.+++.+|+++|+
T Consensus        83 ~~~~GC~~~i~~~~~~~~  100 (100)
T cd03154          83 VYKEPCISKIKDFLKKNL  100 (100)
T ss_pred             ccccccHHHHHHHHHhhC
Confidence            588999999999999874


No 17 
>PF10177 DUF2371:  Uncharacterised conserved protein (DUF2371);  InterPro: IPR018787  This family of proteins with no known function is conserved from nematodes to humans. It includes members of the TMEM200 family of transmembrane proteins. 
Probab=59.62  E-value=15  Score=31.64  Aligned_cols=27  Identities=15%  Similarity=0.360  Sum_probs=18.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhh
Q 022738           10 FAFILKFLNFLQGFIGVSIILYSIWML   36 (293)
Q Consensus        10 lk~lL~~lN~l~~l~Gl~lI~~giwml   36 (293)
                      ..++..++-+++.++|++|-.+|-|--
T Consensus        38 ~Sg~~l~lG~lvllvGiaMAv~GYwp~   64 (141)
T PF10177_consen   38 PSGLFLLLGILVLLVGIAMAVLGYWPK   64 (141)
T ss_pred             HHHHHHHHHHHHHHHhhHhheeecccc
Confidence            344556667777888888877777754


No 18 
>cd03161 TM4SF2_6_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), TM4SF2_6_like subfamily. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". This subfamily contaions transmembrane 4 superfamily 2 (TM4SF2) or Tspan-7, transmembrane 4 superfamily 6 (TM4SF6) or Tspan-6, and related proteins. TM4SF2 has been identified as involved in some forms of X-linked mental retardation.
Probab=58.99  E-value=6  Score=30.57  Aligned_cols=18  Identities=28%  Similarity=0.420  Sum_probs=16.2

Q ss_pred             CCCCCchHHHHHHHHhhc
Q 022738          182 FDPTGELDSLRSFIEDNV  199 (293)
Q Consensus       182 ~y~tGC~~~l~~~l~~n~  199 (293)
                      +|++||.+++.+|+++|+
T Consensus        87 i~~~GC~~~~~~~~~~n~  104 (104)
T cd03161          87 VYQQGCFTLVTSFMEANM  104 (104)
T ss_pred             cchhccHHHHHHHHHHhC
Confidence            588999999999999874


No 19 
>cd03167 oculospanin_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), oculospanin_like family. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". This subfamily contains sequences similar to oculospanin, which is found to be expressed in retinal pigment epithelium, iris, ciliary body, and retinal ganglion cells.
Probab=57.92  E-value=6.4  Score=31.92  Aligned_cols=18  Identities=22%  Similarity=0.316  Sum_probs=16.4

Q ss_pred             CCCCCchHHHHHHHHhhc
Q 022738          182 FDPTGELDSLRSFIEDNV  199 (293)
Q Consensus       182 ~y~tGC~~~l~~~l~~n~  199 (293)
                      +|++||++++.+|+++|+
T Consensus       103 iy~~GC~~~l~~~~~~n~  120 (120)
T cd03167         103 VHLGGCGPPLRRWLRGNL  120 (120)
T ss_pred             chhccCHHHHHHHHHhcC
Confidence            689999999999999874


No 20 
>cd07912 Tweety_N N-terminal domain of the protein encoded by the Drosophila tweety gene and related proteins, a family of chloride ion channels. The protein product of the Drosophila tweety (tty) gene is thought to form a trans-membrane protein with five membrane-spanning regions and a cytoplasmic C-terminus. This N-terminal domain contains the putative transmembrane spanning regions. Tweety has been suggested as a candidate for a large conductance chloride channel, both in vertebrate and insect cells. Three human homologs have been identified and designated TTYH1-3. TTYH2 has been associated with the progression of cancer, and Drosophila melanogaster tweety has been assumed to play a role in development. TTYH2, and TTYH3 bind to and are ubiquinated by Nedd4-2, a HECT type E3 ubiquitin ligase, which most likely plays a role in controlling the cellular levels of tweety family proteins.
Probab=57.58  E-value=29  Score=34.90  Aligned_cols=39  Identities=18%  Similarity=0.370  Sum_probs=28.4

Q ss_pred             hhhHHHHHHHHHHHHHHhhcccchhHHHHHHHHHHHHHH
Q 022738          125 GVGILVCCIALIGCIAAEAISGCCLCFYAILKIILFLLE  163 (293)
Q Consensus       125 ~vG~i~~iis~~GcigA~~~n~c~L~~Y~vll~lLillE  163 (293)
                      ++=++.+++.+++|+|..+.+||.+.+++++-++.+++-
T Consensus       214 ~lL~~~lviC~~~l~gl~r~Sr~~li~~s~~g~l~l~~~  252 (418)
T cd07912         214 GLLSLLLVICLVLLVGLARHSRCLLIVFSVCGLFALIIS  252 (418)
T ss_pred             HHHHHHHHHHHHHHHHHHHhcchHHHHHHHHHHHHHHHH
Confidence            333466667777889999999999999877655554443


No 21 
>cd03160 CD37_CD82_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), CD37_CD82_Like family. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". CD37 is a leukocyte-specific protein, and its restricted expression pattern suggests a role in the immune system. A regulatory role in T-cell proliferation has been suggested. CD82 is a metastasis suppressor implicated in biological processes ranging from fusion, adhesion, and migration to apoptos
Probab=56.71  E-value=4.6  Score=32.17  Aligned_cols=18  Identities=22%  Similarity=0.547  Sum_probs=16.5

Q ss_pred             CCCCCchHHHHHHHHhhc
Q 022738          182 FDPTGELDSLRSFIEDNV  199 (293)
Q Consensus       182 ~y~tGC~~~l~~~l~~n~  199 (293)
                      +|++||++++.+|+++|+
T Consensus        99 iy~~GC~~~l~~~~~~n~  116 (117)
T cd03160          99 VYQEGCMEKLQSWLNENL  116 (117)
T ss_pred             hHHHhhHHHHHHHHHHhc
Confidence            588999999999999986


No 22 
>PRK12585 putative monovalent cation/H+ antiporter subunit G; Reviewed
Probab=56.46  E-value=88  Score=28.38  Aligned_cols=28  Identities=7%  Similarity=0.048  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhhccCC
Q 022738           14 LKFLNFLQGFIGVSIILYSIWMLDQWNH   41 (293)
Q Consensus        14 L~~lN~l~~l~Gl~lI~~giwml~~~~~   41 (293)
                      +-.+-.++.++|+.++.+|..-+.....
T Consensus         5 ~eiI~~vLLliG~~f~ligaIGLlRfPD   32 (197)
T PRK12585          5 IEIIISIMILIGGLLSILAAIGVIRLPD   32 (197)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhcCc
Confidence            3455566777788888777766655443


No 23 
>KOG3357 consensus Uncharacterized conserved protein [Function unknown]
Probab=55.80  E-value=8.5  Score=32.80  Aligned_cols=26  Identities=31%  Similarity=0.726  Sum_probs=23.1

Q ss_pred             ccCcCCcCCCCCCc-hhHHHHHHHhhC
Q 022738          247 IREPLIHQQPIAHS-DIWSSRIREKYG  272 (293)
Q Consensus       247 ~r~pll~~~~~~~~-d~ws~rmrekyg  272 (293)
                      .|-||+.+.+|+|. |.|-+|+.|.|-
T Consensus        11 ~~ipll~tkagprd~~~wvqrlkeey~   37 (167)
T KOG3357|consen   11 SRIPLLKTKAGPRDGDLWVQRLKEEYQ   37 (167)
T ss_pred             hhCcceeccCCCccchHHHHHHHHHHH
Confidence            57899999998887 999999999984


No 24 
>PF13903 Claudin_2:  PMP-22/EMP/MP20/Claudin tight junction
Probab=54.90  E-value=67  Score=26.50  Aligned_cols=30  Identities=23%  Similarity=0.290  Sum_probs=19.1

Q ss_pred             HHHhhhHHHHHHHHH-HHHHHhhcccchhHH
Q 022738          122 SFMGVGILVCCIALI-GCIAAEAISGCCLCF  151 (293)
Q Consensus       122 ~~i~vG~i~~iis~~-GcigA~~~n~c~L~~  151 (293)
                      .++.+|+++.+++++ +.++.+++++.+...
T Consensus        73 ~~~~l~~~~~~~a~~~~~~~~~~~~~~~~~~  103 (172)
T PF13903_consen   73 AFLILGLLLLLFAFVFALIGFCKRSYTLYLF  103 (172)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhccccchhHH
Confidence            566677777666665 677777766644443


No 25 
>cd03165 NET-5_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), NET-5_like family. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". This sub-family contains proteins similar to human tetraspan NET-5.
Probab=54.89  E-value=5.8  Score=30.37  Aligned_cols=18  Identities=22%  Similarity=0.464  Sum_probs=16.1

Q ss_pred             CCCCCchHHHHHHHHhhc
Q 022738          182 FDPTGELDSLRSFIEDNV  199 (293)
Q Consensus       182 ~y~tGC~~~l~~~l~~n~  199 (293)
                      .|.+||++++.+|+++|+
T Consensus        81 ~~~~GC~~~~~~~~~~~~   98 (98)
T cd03165          81 WWKTGCYEKVQQWLVDNL   98 (98)
T ss_pred             hHHhhhHHHHHHHHHhcC
Confidence            588999999999999874


No 26 
>cd03159 TM4SF9_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), TM4SF9_like subfamily. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". This subfamily contaions transmembrane 4 superfamily 9 (TM4SF9) or Tetraspanin-5 and related proteins. TM4SF9 is strongly expressed witin the central nervous system, and expression levels appear to correlate with differentiation status of particular neurons, hinting at a role in neuronal maturation.
Probab=54.46  E-value=6.7  Score=31.63  Aligned_cols=18  Identities=17%  Similarity=0.554  Sum_probs=16.3

Q ss_pred             CCCCCchHHHHHHHHhhc
Q 022738          182 FDPTGELDSLRSFIEDNV  199 (293)
Q Consensus       182 ~y~tGC~~~l~~~l~~n~  199 (293)
                      +|.+||.+++.+|+++|+
T Consensus       104 i~~~GC~~~l~~~~~~n~  121 (121)
T cd03159         104 IHTKGCVQAFEKWLQDNL  121 (121)
T ss_pred             chHhhCHHHHHHHHHhcC
Confidence            688999999999999874


No 27 
>cd03156 uroplakin_I_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), uroplakin_I_like family. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". Uroplakin Ia and Ib are components of the 16nm protein particles, which are packed hexagonally to form 2D crystals of asymmetric unit membranes, and cover the apical surface of mammalian urothelium, contributing to the urinay bladder's permeability barrier function. Uroplakins Ia and Ib are ma
Probab=51.13  E-value=8.9  Score=29.91  Aligned_cols=18  Identities=22%  Similarity=0.373  Sum_probs=16.1

Q ss_pred             CCCCCchHHHHHHHHhhc
Q 022738          182 FDPTGELDSLRSFIEDNV  199 (293)
Q Consensus       182 ~y~tGC~~~l~~~l~~n~  199 (293)
                      +|++||++++.+|+++|.
T Consensus        97 ~~~~GC~~~l~~~~~~~~  114 (114)
T cd03156          97 YNKKGCYEKLSNPIERYA  114 (114)
T ss_pred             hhhcCchHHHHHHHHhcC
Confidence            689999999999999873


No 28 
>PF08694 UFC1:  Ubiquitin-fold modifier-conjugating enzyme 1;  InterPro: IPR014806 Ubiquitin-like (UBL) post-translational modifiers are covalently linked to most, if not all, target protein(s) through an enzymatic cascade analogous to ubiquitylation, consisting of E1 (activating), E2 (conjugating), and E3 (ligating) enzymes. Ubiquitin-fold modifier 1 (Ufm1) a ubiquitin-like protein is activated by a novel E1-like enzyme, Uba5, by forming a high-energy thioester bond. Activated Ufm1 is then transferred to its cognate E2-like enzyme, Ufc1, in a similar thioester linkage. This family represents the E2-like enzyme [].; PDB: 2Z6P_A 2K07_A 2Z6O_A 3EVX_D 3KPA_A.
Probab=49.63  E-value=11  Score=32.53  Aligned_cols=25  Identities=28%  Similarity=0.752  Sum_probs=16.7

Q ss_pred             cCcCCcCCCCCCc-hhHHHHHHHhhC
Q 022738          248 REPLIHQQPIAHS-DIWSSRIREKYG  272 (293)
Q Consensus       248 r~pll~~~~~~~~-d~ws~rmrekyg  272 (293)
                      .-||+...+|+|+ |.|.+|+.|.|-
T Consensus         9 ~IPll~~~AGPrd~~~W~~RLKEEy~   34 (161)
T PF08694_consen    9 KIPLLKTKAGPRDGDLWVQRLKEEYQ   34 (161)
T ss_dssp             CS---SS---TTSCHHHHHHHHHHHH
T ss_pred             hCccccccCCCCCHHHHHHHHHHHHH
Confidence            4699999998888 999999999884


No 29 
>cd03152 CD9_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), CD9 family. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". CD9 is found in virtually all tissues and is potentially involved in developmental processes. It associates with the tetraspanins CD81 and CD63, as well as with some integrin, and has been shown to be involved in a variety of activation, adhesion, and cell motility functions, as well as cell-cell interactions - such as
Probab=48.04  E-value=11  Score=28.34  Aligned_cols=18  Identities=6%  Similarity=0.139  Sum_probs=15.9

Q ss_pred             CCCCCchHHHHHHHHhhc
Q 022738          182 FDPTGELDSLRSFIEDNV  199 (293)
Q Consensus       182 ~y~tGC~~~l~~~l~~n~  199 (293)
                      .|.+||.+++.+|+++|+
T Consensus        67 ~~~~gC~~~i~~~~~~~~   84 (84)
T cd03152          67 LITKSCPDAIDDVFNSKL   84 (84)
T ss_pred             hccCCCcHHHHHHHHccC
Confidence            478899999999999874


No 30 
>cd03127 tetraspanin_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL). Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. The tetraspanin family contains CD9, CD63, CD37, CD53, CD82, CD151, and CD81, amongst others. Tetraspanins are involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, cancer, and others. Their various functions may relate to their ability to act as molecular facilitators, grouping specific cell-surface proteins and affecting formation and stability of signaling complexes. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web", which may also include integr
Probab=47.18  E-value=11  Score=27.79  Aligned_cols=18  Identities=28%  Similarity=0.527  Sum_probs=15.7

Q ss_pred             CCCCCchHHHHHHHHhhc
Q 022738          182 FDPTGELDSLRSFIEDNV  199 (293)
Q Consensus       182 ~y~tGC~~~l~~~l~~n~  199 (293)
                      .|++||.+++.+|++++.
T Consensus        73 ~~~~GC~~~~~~~~~~~~   90 (90)
T cd03127          73 LYTEGCLEKLVDFLRSNL   90 (90)
T ss_pred             hhhHccHHHHHHHHHhhC
Confidence            478999999999999863


No 31 
>cd03155 CD151_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), CD151_Like family. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". CD151strongly associates with integrins, especially alpha3beta1, alpha6beta1, alpha7beta1, and alpha6beta4; it may play roles in cell-cell adhesion, cell migration, platelet aggregation, and angiogenesis. For example, CD151 is  is involved in regulation of migration of neutrophils, endothelial cells, and 
Probab=45.75  E-value=15  Score=28.65  Aligned_cols=18  Identities=22%  Similarity=0.409  Sum_probs=15.6

Q ss_pred             CCC--CCchHHHHHHHHhhc
Q 022738          182 FDP--TGELDSLRSFIEDNV  199 (293)
Q Consensus       182 ~y~--tGC~~~l~~~l~~n~  199 (293)
                      .|.  +||.+++.+|+++|+
T Consensus        91 ~~~~~~GC~~~~~~~~~~~~  110 (110)
T cd03155          91 IYKVEGGCIPKLEDFLYDHL  110 (110)
T ss_pred             cccccCChHHHHHHHHHHhC
Confidence            466  899999999999874


No 32 
>PF05915 DUF872:  Eukaryotic protein of unknown function (DUF872);  InterPro: IPR008590 This entry represents several uncharacterised eukaryotic transmembrane proteins. The function of this currently unknown.
Probab=44.33  E-value=57  Score=26.95  Aligned_cols=24  Identities=13%  Similarity=0.192  Sum_probs=18.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhhc
Q 022738           15 KFLNFLQGFIGVSIILYSIWMLDQ   38 (293)
Q Consensus        15 ~~lN~l~~l~Gl~lI~~giwml~~   38 (293)
                      ..+-++++++|..++..|+.++..
T Consensus        44 I~la~~Lli~G~~li~~g~l~~~~   67 (115)
T PF05915_consen   44 IALAVFLLIFGTVLIIIGLLLFFG   67 (115)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhc
Confidence            345567788899999999987764


No 33 
>PF06724 DUF1206:  Domain of Unknown Function (DUF1206);  InterPro: IPR009597 This region consists of two a pair of transmembrane helices and occurs three times in each of the family member proteins.
Probab=43.85  E-value=25  Score=26.12  Aligned_cols=21  Identities=33%  Similarity=0.808  Sum_probs=18.6

Q ss_pred             HHHHHHHHHHHHHHHHhhhhc
Q 022738           18 NFLQGFIGVSIILYSIWMLDQ   38 (293)
Q Consensus        18 N~l~~l~Gl~lI~~giwml~~   38 (293)
                      ..+++++|+.++++|+|.+.+
T Consensus        47 ~~ll~~vg~gli~~gi~~~~~   67 (73)
T PF06724_consen   47 RWLLGAVGLGLIGYGIWQFVK   67 (73)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            478899999999999998865


No 34 
>PF01601 Corona_S2:  Coronavirus S2 glycoprotein;  InterPro: IPR002552 The type I glycoprotein S of Coronavirus, trimers of which constitute the typical viral spikes, is assembled into virions through noncovalent interactions with the M protein. The spike glycoprotein is translated as a large polypeptide that is subsequently cleaved to S1 IPR002551 from INTERPRO and S2 []. Both chimeric S proteins appeared to cause cell fusion when expressed individually, suggesting that they were biologically fully active []. The spike is a type I membrane glycoprotein that possesses a conserved transmembrane anchor and an unusual cysteine-rich (cys) domain that bridges the putative junction of the anchor and the cytoplasmic tail [].; GO: 0006944 cellular membrane fusion, 0046813 virion attachment, binding of host cell surface receptor, 0016021 integral to membrane, 0019031 viral envelope; PDB: 2BEQ_B 2FXP_A 1ZVB_A 1WNC_D 1ZV8_H 1ZV7_B 1WYY_B 1ZVA_A 2BEZ_F 1WDG_A ....
Probab=42.69  E-value=8.2  Score=40.34  Aligned_cols=28  Identities=18%  Similarity=0.637  Sum_probs=0.0

Q ss_pred             CcchhhhHHHhhhHHH---------HHHHHHHHHHHh
Q 022738          115 PAPWFIYSFMGVGILV---------CCIALIGCIAAE  142 (293)
Q Consensus       115 ~~~wfIY~~i~vG~i~---------~iis~~GcigA~  142 (293)
                      --||.+++.|+++.+.         |.+||+||||-.
T Consensus       545 KWPWyVWL~i~~~li~~~~~l~~~~~~TGCCGc~~C~  581 (610)
T PF01601_consen  545 KWPWYVWLAIILALIAFALILLWCCCMTGCCGCCGCF  581 (610)
T ss_dssp             -------------------------------------
T ss_pred             ehHHHHHHHHHHHHHHHHHHHHHHHHhcCCccccchh
Confidence            3478777777666543         345566444433


No 35 
>cd03162 peripherin_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), peripherin_like family. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". Peripherin, or RDS (retinal degradation slow) is a glycoprotein expressed in vertebrate photoreceptors, located at the rim of the disc membranes of the photoreceptor outer segments. RDS is thought to play a major role in folding and stacking of the discs. Mutations in RDS have been linked to her
Probab=41.90  E-value=13  Score=31.77  Aligned_cols=25  Identities=12%  Similarity=0.182  Sum_probs=20.7

Q ss_pred             CCCCCCCCCCCCchHHHHHHHHhhc
Q 022738          175 RWEKDLPFDPTGELDSLRSFIEDNV  199 (293)
Q Consensus       175 dW~~~iP~y~tGC~~~l~~~l~~n~  199 (293)
                      ....+.++|++||.+++.+|+++.+
T Consensus       119 ~~~~~~~i~~~GC~~~l~~~~~~~~  143 (143)
T cd03162         119 YQTEELNLWTRGCREALLEYYTSKM  143 (143)
T ss_pred             cCcccccchHHHHHHHHHHHHHhcC
Confidence            3456688999999999999998753


No 36 
>PF05835 Synaphin:  Synaphin protein;  InterPro: IPR008849 This family consists of several eukaryotic synaphin 1 and 2 proteins. Synaphin/complexin is a cytosolic protein that preferentially binds to syntaxin within the SNARE complex. Synaphin promotes SNAREs to form precomplexes that oligomerise into higher order structures. A peptide from the central, syntaxin binding domain of synaphin competitively inhibits these two proteins from interacting and prevents SNARE complexes from oligomerising. It is thought that oligomerisation of SNARE complexes into a higher order structure creates a SNARE scaffold for efficient, regulated fusion of synaptic vesicles []. Synaphin promotes neuronal exocytosis by promoting interaction between the complementary syntaxin and synaptobrevin transmembrane regions that reside in opposing membranes prior to fusion [].; GO: 0019905 syntaxin binding, 0006836 neurotransmitter transport; PDB: 3RL0_m 3RK3_E 1L4A_E 1KIL_E.
Probab=40.53  E-value=15  Score=31.59  Aligned_cols=18  Identities=39%  Similarity=0.641  Sum_probs=10.5

Q ss_pred             hhHHHHHHHhhCCCCCCC
Q 022738          261 DIWSSRIREKYGLNGGGE  278 (293)
Q Consensus       261 d~ws~rmrekygl~~~~~  278 (293)
                      ..-+++||+||||..++.
T Consensus        62 e~mRq~IRdKY~l~k~e~   79 (139)
T PF05835_consen   62 EKMRQHIRDKYGLKKKEE   79 (139)
T ss_dssp             HHHHHHHHHHHT------
T ss_pred             HHHHHHHHhhcccccccc
Confidence            566899999999999876


No 37 
>PF10176 DUF2370:  Protein of unknown function (DUF2370);  InterPro: IPR019325 Proteins in this family are conserved from fungi to humans. They include the human NEDD4 family-interacting proteins and the yeast BSD2 metal homeostatis proteins. 
Probab=38.35  E-value=32  Score=31.99  Aligned_cols=33  Identities=18%  Similarity=0.481  Sum_probs=28.6

Q ss_pred             CCcchhhhHHHhhhHHHHHHHHHHHHHHhhccc
Q 022738          114 LPAPWFIYSFMGVGILVCCIALIGCIAAEAISG  146 (293)
Q Consensus       114 l~~~wfIY~~i~vG~i~~iis~~GcigA~~~n~  146 (293)
                      -..+|+-|++|++|.++++-++++.+=+.+.-+
T Consensus       191 ~~~~wla~~Lm~~G~fI~irsi~dY~rVKR~Er  223 (233)
T PF10176_consen  191 QSNPWLAYILMAFGWFIFIRSIIDYWRVKRMER  223 (233)
T ss_pred             cCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            456788899999999999999999998886554


No 38 
>PF15050 SCIMP:  SCIMP protein
Probab=37.73  E-value=64  Score=27.23  Aligned_cols=33  Identities=30%  Similarity=0.288  Sum_probs=23.6

Q ss_pred             HHHHhhchhHHHHHHHHHHHHHHHHHHHHHHHHh
Q 022738          193 SFIEDNVDICKWVGITVVIVQALSLLLAIILRAM  226 (293)
Q Consensus       193 ~~l~~n~~ii~~v~l~v~iiQilgillA~~L~~~  226 (293)
                      +|-++|+.++..+++.+ +--.+|+++-|+.+..
T Consensus         2 ~WWr~nFWiiLAVaII~-vS~~lglIlyCvcR~~   34 (133)
T PF15050_consen    2 SWWRDNFWIILAVAIIL-VSVVLGLILYCVCRWQ   34 (133)
T ss_pred             chHHhchHHHHHHHHHH-HHHHHHHHHHHHHHHH
Confidence            68899999988888543 4456777777766644


No 39 
>PF05478 Prominin:  Prominin;  InterPro: IPR008795 The prominins are an emerging family of proteins that, among the multispan membrane proteins, display a novel topology. Mouse and Homo sapiens prominin and (Mus musculus) prominin-like 1 (PROML1) are predicted to contain five membrane spanning domains, with an N-terminal domain exposed to the extracellular space followed by four, alternating small cytoplasmic and large extracellular, loops and a cytoplasmic C-terminal domain []. The exact function of prominin is unknown although in humans defects in PROM1, the gene coding for prominin, cause retinal degeneration [].; GO: 0016021 integral to membrane
Probab=36.01  E-value=17  Score=39.24  Aligned_cols=24  Identities=21%  Similarity=0.096  Sum_probs=12.5

Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhcc
Q 022738          149 LCFYAILKIILFLLEAALVAFIAI  172 (293)
Q Consensus       149 L~~Y~vll~lLillEia~~a~i~~  172 (293)
                      =.+|.++++++.++-++.++.+|.
T Consensus       139 R~~l~~~L~~~~~~il~g~i~aF~  162 (806)
T PF05478_consen  139 RGCLGILLLLLTLIILFGVICAFV  162 (806)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHH
Confidence            345555555555555555544443


No 40 
>PF01988 VIT1:  VIT family;  InterPro: IPR008217 Proteins containing this entry have no known function and are predicted to be integral membrane proteins. They include the Ccc1 protein from Saccharomyces cerevisiae (Baker's yeast) (P47818 from SWISSPROT) that may have a role in regulating calcium levels [].
Probab=35.26  E-value=58  Score=29.19  Aligned_cols=22  Identities=27%  Similarity=0.379  Sum_probs=16.7

Q ss_pred             CCchhHHHHHHHhhCCCCCCCc
Q 022738          258 AHSDIWSSRIREKYGLNGGGEQ  279 (293)
Q Consensus       258 ~~~d~ws~rmrekygl~~~~~~  279 (293)
                      ..+|.+..-|+|++|++..+..
T Consensus       108 ~~~~~~~~m~~ee~g~~~~~~~  129 (213)
T PF01988_consen  108 KDKDALDFMMREELGLSPEEEE  129 (213)
T ss_pred             hCchHHHHHHhhhccCCccccc
Confidence            3345699999999999985544


No 41 
>KOG3950 consensus Gamma/delta sarcoglycan [Cytoskeleton]
Probab=34.97  E-value=36  Score=32.04  Aligned_cols=27  Identities=30%  Similarity=0.545  Sum_probs=24.1

Q ss_pred             cchhHHHHHHHHHHHHHHHHHHHhhcc
Q 022738          146 GCCLCFYAILKIILFLLEAALVAFIAI  172 (293)
Q Consensus       146 ~c~L~~Y~vll~lLillEia~~a~i~~  172 (293)
                      +-||.+|..++++++++-++++.|++.
T Consensus        34 KrcLY~fvLlL~i~ivvNLalTiWIlk   60 (292)
T KOG3950|consen   34 KRCLYTFVLLLMILIVVNLALTIWILK   60 (292)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            458899999999999999999999886


No 42 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=31.80  E-value=39  Score=27.98  Aligned_cols=23  Identities=26%  Similarity=0.550  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q 022738          203 KWVGITVVIVQALSLLLAIILRA  225 (293)
Q Consensus       203 ~~v~l~v~iiQilgillA~~L~~  225 (293)
                      +|+.++++++=++.+++.+++.+
T Consensus         1 RW~l~~iii~~i~l~~~~~~~~~   23 (130)
T PF12273_consen    1 RWVLFAIIIVAILLFLFLFYCHN   23 (130)
T ss_pred             CeeeHHHHHHHHHHHHHHHHHHH
Confidence            36666666666666665555543


No 43 
>cd02432 Nodulin-21_like_1 Nodulin-21 and CCC1-related protein family. Nodulin-21_like_1: This is a family of proteins closely related to nodulin-21, a plant nodule-specific protein that may be involved in symbiotic nitrogen fixation. This family is also related to CCC1, a yeast vacuole transmembrane protein that functions as an iron and manganese transporter.
Probab=30.58  E-value=81  Score=28.74  Aligned_cols=21  Identities=19%  Similarity=0.386  Sum_probs=16.0

Q ss_pred             CchhHHHHHHHhhCCCCCCCc
Q 022738          259 HSDIWSSRIREKYGLNGGGEQ  279 (293)
Q Consensus       259 ~~d~ws~rmrekygl~~~~~~  279 (293)
                      +++.-...|||+||++..+.+
T Consensus       114 ~~~~~~~~~~~e~g~~~~~~~  134 (218)
T cd02432         114 AKDALEAHARDELGITEGEYA  134 (218)
T ss_pred             hcChHHHHHHHhcCCCCCCCC
Confidence            345678899999999886654


No 44 
>PF04156 IncA:  IncA protein;  InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion. The inclusion is nonfusogenic with lysosomes but intercepts lipids from a host cell exocytic pathway. Initiation of chlamydial development is concurrent with modification of the inclusion membrane by a set of C. trachomatis-encoded proteins collectively designated Incs. One of these Incs, IncA (Inclusion membrane protein A), is functionally associated with the homotypic fusion of inclusions [].
Probab=30.33  E-value=79  Score=27.42  Aligned_cols=22  Identities=18%  Similarity=0.369  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhh
Q 022738           15 KFLNFLQGFIGVSIILYSIWML   36 (293)
Q Consensus        15 ~~lN~l~~l~Gl~lI~~giwml   36 (293)
                      .+.+++..++|+++++.|+-.+
T Consensus         5 ~i~~i~~iilgilli~~gI~~L   26 (191)
T PF04156_consen    5 RIISIILIILGILLIASGIAAL   26 (191)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            3455555556666555555443


No 45 
>cd02434 Nodulin-21_like_3 Nodulin-21 and CCC1-related protein family. Nodulin-21_like_3: This is a family of proteins closely related to nodulin-21, a plant nodule-specific protein that may be involved in symbiotic nitrogen fixation. This family is also related to CCC1, a yeast vacuole transmembrane protein that functions as an iron and manganese transporter.
Probab=29.88  E-value=67  Score=29.31  Aligned_cols=21  Identities=14%  Similarity=0.205  Sum_probs=15.7

Q ss_pred             CCCchhH-HHHHHHhhCCCCCC
Q 022738          257 IAHSDIW-SSRIREKYGLNGGG  277 (293)
Q Consensus       257 ~~~~d~w-s~rmrekygl~~~~  277 (293)
                      ..++|.| ...|||++|++..+
T Consensus       108 ~~~~~~~~~~m~~~elg~~~~~  129 (225)
T cd02434         108 SKYRKLFVDIMMTEELGLIPDD  129 (225)
T ss_pred             HhCchhhHHHHHHhhccCCCCc
Confidence            3344666 77899999998865


No 46 
>PRK07375 putative monovalent cation/H+ antiporter subunit C; Reviewed
Probab=29.67  E-value=3.1e+02  Score=22.29  Aligned_cols=17  Identities=29%  Similarity=0.399  Sum_probs=11.1

Q ss_pred             HhhhHHHHHHHHHHHHH
Q 022738          124 MGVGILVCCIALIGCIA  140 (293)
Q Consensus       124 i~vG~i~~iis~~Gcig  140 (293)
                      ..++++++.+|+.|.+-
T Consensus         6 ~~~~~~Lf~iG~~gll~   22 (112)
T PRK07375          6 YALAIALLVIGLYGLIF   22 (112)
T ss_pred             HHHHHHHHHHHHHHHHh
Confidence            45566777777776664


No 47 
>cd03157 TM4SF12_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), TM4SF12_like family. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". This sub-family contains proteins similar to human transmembrane 4 superfamily member 12 (TM4SF12).
Probab=29.12  E-value=36  Score=27.20  Aligned_cols=17  Identities=24%  Similarity=0.251  Sum_probs=14.9

Q ss_pred             CCCCCchHHHHHHHHhh
Q 022738          182 FDPTGELDSLRSFIEDN  198 (293)
Q Consensus       182 ~y~tGC~~~l~~~l~~n  198 (293)
                      +|++||++++.+|++..
T Consensus        86 iy~~GC~~~i~~~l~~~  102 (103)
T cd03157          86 LYQEGCGPKIYSFIRGT  102 (103)
T ss_pred             ccccchHHHHHHHHHhc
Confidence            68899999999999863


No 48 
>KOG1314 consensus DHHC-type Zn-finger protein [General function prediction only]
Probab=29.03  E-value=3.3e+02  Score=27.15  Aligned_cols=64  Identities=20%  Similarity=0.327  Sum_probs=33.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhccccc--cCCCCchhhhhhhhccCcCCcCCC----CCCchhHHHHHHHhhC
Q 022738          204 WVGITVVIVQALSLLLAIILRAMVSTRRT--NFDEEDDYESERIRIREPLIHQQP----IAHSDIWSSRIREKYG  272 (293)
Q Consensus       204 ~v~l~v~iiQilgillA~~L~~~i~~~~~--~ydsdD~~~~~r~~~r~pll~~~~----~~~~d~ws~rmrekyg  272 (293)
                      ..++.+.++-.+++++-+.|..+++||..  +|+  ||..-.|+   +.+-++-.    -.-++-|+.-+||-.-
T Consensus       192 slgla~gv~la~t~Lf~~qlk~Il~nrt~IE~wi--~~Ka~~rr---~~~~~d~~~~f~ypydlgWr~n~r~vf~  261 (414)
T KOG1314|consen  192 SLGLAIGVVLALTMLFFIQLKQILNNRTGIESWI--VEKAMDRR---EYYFNDDEGEFTYPYDLGWRINLREVFF  261 (414)
T ss_pred             HhHHHHHHHHHHHHHHHHHHHHHHcCCcchHHHH--HHHHHHHH---HhhccCCCCceeeeccccccccHHHHhh
Confidence            34444444555666666777766665432  132  33334443   23333311    3334559988888753


No 49 
>KOG1362 consensus Choline transporter-like protein [Lipid transport and metabolism]
Probab=28.09  E-value=6.9e+02  Score=26.34  Aligned_cols=44  Identities=23%  Similarity=0.365  Sum_probs=30.9

Q ss_pred             CCCchHHHHHHHHhhchhHHHHHHHHHHHHHHHHHHHHHHHHhh
Q 022738          184 PTGELDSLRSFIEDNVDICKWVGITVVIVQALSLLLAIILRAMV  227 (293)
Q Consensus       184 ~tGC~~~l~~~l~~n~~ii~~v~l~v~iiQilgillA~~L~~~i  227 (293)
                      ..+-...+...+.....+....++...++.++.+++.+.++..+
T Consensus       209 ~i~~~~~~~~~~~~~~~~l~~~~Iv~~v~~vv~~l~~i~lr~RI  252 (577)
T KOG1362|consen  209 TIGFTSSLFVAVGNQLTLLDAVGIVLTVISVVLVLYIIFLRKRI  252 (577)
T ss_pred             eeecchHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34444566666666666666688888888888888888777654


No 50 
>PRK11901 hypothetical protein; Reviewed
Probab=27.66  E-value=53  Score=32.03  Aligned_cols=23  Identities=30%  Similarity=0.418  Sum_probs=19.0

Q ss_pred             hHHHhhhHHHHHHHHHHHHHHhh
Q 022738          121 YSFMGVGILVCCIALIGCIAAEA  143 (293)
Q Consensus       121 Y~~i~vG~i~~iis~~GcigA~~  143 (293)
                      +++||+|++++++=++|+-.|.+
T Consensus        37 h~MiGiGilVLlLLIi~IgSALk   59 (327)
T PRK11901         37 HMMIGIGILVLLLLIIAIGSALK   59 (327)
T ss_pred             HHHHHHHHHHHHHHHHHHhhhcc
Confidence            58999999998888888766664


No 51 
>PF13706 PepSY_TM_3:  PepSY-associated TM helix
Probab=24.18  E-value=1.1e+02  Score=19.98  Aligned_cols=22  Identities=23%  Similarity=0.265  Sum_probs=19.0

Q ss_pred             HHHhhhHHHHHHHHHHHHHHhh
Q 022738          122 SFMGVGILVCCIALIGCIAAEA  143 (293)
Q Consensus       122 ~~i~vG~i~~iis~~GcigA~~  143 (293)
                      +-+.+|.+++++++.|.+....
T Consensus        11 ~Gl~~g~~l~~~~~tG~~~~f~   32 (37)
T PF13706_consen   11 LGLILGLLLFVIFLTGAVMVFR   32 (37)
T ss_pred             HHHHHHHHHHHHHHHhHHHHHH
Confidence            7788999999999999987764


No 52 
>PF04156 IncA:  IncA protein;  InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion. The inclusion is nonfusogenic with lysosomes but intercepts lipids from a host cell exocytic pathway. Initiation of chlamydial development is concurrent with modification of the inclusion membrane by a set of C. trachomatis-encoded proteins collectively designated Incs. One of these Incs, IncA (Inclusion membrane protein A), is functionally associated with the homotypic fusion of inclusions [].
Probab=23.90  E-value=2.3e+02  Score=24.45  Aligned_cols=21  Identities=14%  Similarity=0.199  Sum_probs=13.1

Q ss_pred             HHHhhhHHHHHHHHHHHHHHh
Q 022738          122 SFMGVGILVCCIALIGCIAAE  142 (293)
Q Consensus       122 ~~i~vG~i~~iis~~GcigA~  142 (293)
                      +++++|+++.+.|+.+++-..
T Consensus        10 ~~iilgilli~~gI~~Lv~~~   30 (191)
T PF04156_consen   10 ILIILGILLIASGIAALVLFI   30 (191)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            566777776666666644443


No 53 
>PF07423 DUF1510:  Protein of unknown function (DUF1510);  InterPro: IPR009988 This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown.
Probab=23.77  E-value=71  Score=29.36  Aligned_cols=26  Identities=23%  Similarity=0.306  Sum_probs=21.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhhc
Q 022738           13 ILKFLNFLQGFIGVSIILYSIWMLDQ   38 (293)
Q Consensus        13 lL~~lN~l~~l~Gl~lI~~giwml~~   38 (293)
                      .=.+||+++.++-+++|+++..+|+-
T Consensus        12 ~N~iLNiaI~IV~lLIiiva~~lf~~   37 (217)
T PF07423_consen   12 TNKILNIAIGIVSLLIIIVAYQLFFG   37 (217)
T ss_pred             hhhhHHHHHHHHHHHHHHHhhhheec
Confidence            45789999999998888888877763


No 54 
>PF13908 Shisa:  Wnt and FGF inhibitory regulator
Probab=23.75  E-value=38  Score=29.47  Aligned_cols=22  Identities=23%  Similarity=0.258  Sum_probs=12.3

Q ss_pred             HHHhhhHHHHHHHHHHHHHHhh
Q 022738          122 SFMGVGILVCCIALIGCIAAEA  143 (293)
Q Consensus       122 ~~i~vG~i~~iis~~GcigA~~  143 (293)
                      +.|++|++++++.+++.+++..
T Consensus        78 ~~iivgvi~~Vi~Iv~~Iv~~~   99 (179)
T PF13908_consen   78 TGIIVGVICGVIAIVVLIVCFC   99 (179)
T ss_pred             eeeeeehhhHHHHHHHhHhhhe
Confidence            4456666665555555555443


No 55 
>PF04790 Sarcoglycan_1:  Sarcoglycan complex subunit protein;  InterPro: IPR006875 The dystrophin glycoprotein complex (DGC) is a membrane-spanning complex that links the interior cytoskeleton to the extracellular matrix in muscle. The sarcoglycan complex is a subcomplex within the DGC and is composed of several muscle-specific, transmembrane proteins (alpha-, beta-, gamma-, delta- and zeta-sarcoglycan). The sarcoglycans are asparagine-linked glycosylated proteins with single transmembrane domains. This family contains beta, gamma and delta members [, ].; GO: 0007010 cytoskeleton organization, 0016012 sarcoglycan complex, 0016021 integral to membrane
Probab=23.51  E-value=73  Score=30.04  Aligned_cols=32  Identities=25%  Similarity=0.423  Sum_probs=27.1

Q ss_pred             HhhcccchhHHHHHHHHHHHHHHHHHHHhhcc
Q 022738          141 AEAISGCCLCFYAILKIILFLLEAALVAFIAI  172 (293)
Q Consensus       141 A~~~n~c~L~~Y~vll~lLillEia~~a~i~~  172 (293)
                      -.-.++.||+++.++++++.++-+++..+++.
T Consensus         6 i~Gwrk~cly~~vllL~il~iiNL~LTiwIl~   37 (264)
T PF04790_consen    6 IYGWRKRCLYLFVLLLFILAIINLALTIWILK   37 (264)
T ss_pred             hhhhhhhhHHHHHHHHHHHHHHHHHHHhhhhe
Confidence            34467889999999999999999999988775


No 56 
>PF09323 DUF1980:  Domain of unknown function (DUF1980);  InterPro: IPR015402  Members of this occur in gene pairs with members of PF03773 from PFAM. The N-terminal region contains several predicted transmembrane helix regions while the few invariant residues (G, CxxD, and W) occur in the C-terminal region.  Members of this family are found in a set of prokaryotic hypothetical proteins. Their exact function has not, as yet, been defined. 
Probab=22.77  E-value=3.9e+02  Score=23.23  Aligned_cols=45  Identities=20%  Similarity=0.168  Sum_probs=28.5

Q ss_pred             chhhhHHHhhhHHHHHHHHHHHHHHhhcccc-------------hhHHHHHHHHHHHH
Q 022738          117 PWFIYSFMGVGILVCCIALIGCIAAEAISGC-------------CLCFYAILKIILFL  161 (293)
Q Consensus       117 ~wfIY~~i~vG~i~~iis~~GcigA~~~n~c-------------~L~~Y~vll~lLil  161 (293)
                      |-.++.....++++++++++-.....+..+.             -+..|.++++-+++
T Consensus        29 P~~~~~~~~a~i~l~ilai~q~~~~~~~~~~~~~~h~h~~~~~~~~~~y~l~~iPll~   86 (182)
T PF09323_consen   29 PRYIPLLYFAAILLLILAIVQLWRWFRPKRRKEDCHDHGHSKSKKLWSYFLFLIPLLI   86 (182)
T ss_pred             ccHHHHHHHHHHHHHHHHHHHHHHHHhcccccccccccccccccccHHHHHHHHHHHH
Confidence            3345567777888888888877777655443             45556665554443


No 57 
>PF13314 DUF4083:  Domain of unknown function (DUF4083)
Probab=21.86  E-value=2.2e+02  Score=20.95  Aligned_cols=33  Identities=9%  Similarity=0.338  Sum_probs=22.1

Q ss_pred             HHHHHHHHHHHHHHHHHhhccccccCCCCchhh
Q 022738          209 VVIVQALSLLLAIILRAMVSTRRTNFDEEDDYE  241 (293)
Q Consensus       209 v~iiQilgillA~~L~~~i~~~~~~ydsdD~~~  241 (293)
                      +.++-++++.++.+.|...++..+.+.++|+.+
T Consensus        13 i~l~vl~~~~Ftl~IRri~~~s~~kkq~~~~~e   45 (58)
T PF13314_consen   13 IILIVLFGASFTLFIRRILINSNAKKQDVDSME   45 (58)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhccccccchhHHH
Confidence            444556778888888888766666666655543


No 58 
>PRK12585 putative monovalent cation/H+ antiporter subunit G; Reviewed
Probab=21.46  E-value=92  Score=28.26  Aligned_cols=22  Identities=32%  Similarity=0.422  Sum_probs=17.5

Q ss_pred             hhhhHHHhhhHHHHHHHHHHHH
Q 022738          118 WFIYSFMGVGILVCCIALIGCI  139 (293)
Q Consensus       118 wfIY~~i~vG~i~~iis~~Gci  139 (293)
                      +.+++++.+|++++++|-+|.+
T Consensus         7 iI~~vLLliG~~f~ligaIGLl   28 (197)
T PRK12585          7 IIISIMILIGGLLSILAAIGVI   28 (197)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            3456889999999999888864


No 59 
>PF06341 DUF1056:  Protein of unknown function (DUF1056);  InterPro: IPR009406 This entry is represented by Bacteriophage bIL286, Orf42. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several putative head-tail joining bacteriophage proteins.
Probab=20.89  E-value=2.1e+02  Score=21.34  Aligned_cols=30  Identities=13%  Similarity=0.332  Sum_probs=26.3

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHhhhh
Q 022738            8 ISFAFILKFLNFLQGFIGVSIILYSIWMLD   37 (293)
Q Consensus         8 ~~lk~lL~~lN~l~~l~Gl~lI~~giwml~   37 (293)
                      .++|.+-+.+.+++++.|...+.++.+++.
T Consensus         5 ~~fk~iW~~~DIi~Fila~i~i~it~F~~n   34 (63)
T PF06341_consen    5 KFFKTIWKYFDIILFILAMIFINITAFLIN   34 (63)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            468889999999999999999999998764


No 60 
>PF10724 DUF2516:  Protein of unknown function (DUF2516);  InterPro: IPR019662  This entry represents a conserved protein in Actinobacteria. The function is not known. 
Probab=20.07  E-value=4.5e+02  Score=21.21  Aligned_cols=31  Identities=10%  Similarity=0.394  Sum_probs=24.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhhhccCC
Q 022738           11 AFILKFLNFLQGFIGVSIILYSIWMLDQWNH   41 (293)
Q Consensus        11 k~lL~~lN~l~~l~Gl~lI~~giwml~~~~~   41 (293)
                      ..+..+.+.+++++.++.++.++|-+.+--.
T Consensus         2 ~~l~~~~~~i~~~l~~~~~~~~v~Alv~aa~   32 (100)
T PF10724_consen    2 SFLFQIQGWILLALSLVALVLAVWALVDAAR   32 (100)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            3566777888889999999999999887544


Done!