Citrus Sinensis ID: 022748


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290--
MQNQEKCGASCEFDDWSNFEDEDIMQQQSDIKAEEAQKVPFVADKEPLSALASEYQSGSPILLEKIKVLGEQYAAIRRTRGDGNCFFRSFMFSYLEHILASQDQAEVDRIKAKVEECRRTLQSLGHADFTFEDFFALFLEQLDNVLQGNEFSISHGELVVRSRDQSVSDYVVMFFRFVTSGEIRKRSEFFEPFILGLTNATVEQFCKSSVEPMGEESDHVHITALSDALGVPIRVVYLDRSSCDSGGASVNHHDFIPTPGDCPNATSGSTETTIPFITLLYRPGHYDILYPK
ccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHccccHHHHHHHHHHHHHccHHccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHcccccccccccccHHHHHHHcccccccccHHHHHHHHHHHHcccEEEEEEccccccccccccccEEcccccccccccccccccccccEEEEEEccccccccccc
********************************************KEPLSALASEYQSGSPILLEKIKVLGEQYAAIRRTRGDGNCFFRSFMFSYLEHILASQDQAEVDRIKAKVEECRRTLQSLGHADFTFEDFFALFLEQLDNVLQGNEFSISHGELVVRSRDQSVSDYVVMFFRFVTSGEIRKRSEFFEPFILGLTNATVEQFCKSSVEPMGEESDHVHITALSDALGVPIRVVYLDRSSCDSGGASVNHHDFIPTPG**********ETTIPFITLLYRPGHYDILYPK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQNQEKCGASCEFDDWSNFEDEDIMQQQSDIKAEEAQKVPFVADKEPLSALASEYQSGSPILLEKIKVLGEQYAAIRRTRGDGNCFFRSFMFSYLEHILASQDQAEVDRIKAKVEECRRTLQSLGHADFTFEDFFALFLEQLDNVLQGNEFSISHGELVVRSRDQSVSDYVVMFFRFVTSGEIRKRSEFFEPFILGLTNATVEQFCKSSVEPMGEESDHVHITALSDALGVPIRVVYLDRSSCDSGGASVNHHDFIPTPGDCPNATSGSTETTIPFITLLYRPGHYDILYPK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin thioesterase otubain-like Possible hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation.confidentQ8LG98
Ubiquitin thioesterase OTUB1 Hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation. Regulator of T-cell anergy, a phenomenon that occurs when T-cells are rendered unresponsive to antigen rechallenge and no longer respond to their cognate antigen. Acts via its interaction with RNF128/GRAIL. Surprisingly, it regulates RNF128-mediated ubiquitination, but does not deubiquitinate polyubiquitinated RNF128. Deubiquitinates estrogen receptor alpha (ESR1). Mediates deubiquitination of 'Lys-48'-linked polyubiquitin chains, but not 'Lys-63'-linked polyubiquitin chains. Not able to cleave di-ubiquitin. Also capable of removing NEDD8 from NEDD8 conjugates, but with a nuch lower preference compared to 'Lys-48'-linked ubiquitin.probableB2RYG6
Ubiquitin thioesterase OTUB1 Hydrolase that can remove conjugated ubiquitin from proteins and plays an important regulatory role at the level of protein turnover by preventing degradation. Regulator of T-cell anergy, a phenomenon that occurs when T-cells are rendered unresponsive to antigen rechallenge and no longer respond to their cognate antigen. Acts via its interaction with RNF128/GRAIL, a crucial inductor of CD4 T-cell anergy. Isoform 1 destabilizes RNF128, leading to prevent anergy. In contrast, isoform 2 stabilizes RNF128 and promotes anergy. Surprisingly, it regulates RNF128-mediated ubiquitination, but does not deubiquitinate polyubiquitinated RNF128. Deubiquitinates estrogen receptor alpha (ESR1). Mediates deubiquitination of 'Lys-48'-linked polyubiquitin chains, but not 'Lys-63'-linked polyubiquitin chains. Not able to cleave di-ubiquitin. Also capable of removing NEDD8 from NEDD8 conjugates, but with a nuch lower preference compared to 'Lys-48'-linked ubiquitin.probableQ96FW1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.19.-Omega peptidases.probable
3.4.19.12Ubiquitinyl hydrolase 1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DDG, chain A
Confidence level:very confident
Coverage over the Query: 19-259,273-291
View the alignment between query and template
View the model in PyMOL
Template: 4DHI, chain B
Confidence level:very confident
Coverage over the Query: 36-260,271-292
View the alignment between query and template
View the model in PyMOL