Citrus Sinensis ID: 022759


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290--
MDVDHVDHYRVLGLPSGEEGAKLTEKEISKAYKWKALELHPDKRPDDPDAHDNFQKLKSSYEILKDEKARKLFDDLLKIKREKQQRQSQQDGKRRKMMSDLEERERAAFAPDPAVKARQEEEKIARQLKEEIERIRAMHENKRTPAAFASVKETKQSGSGGVGLDKEKVLKVSWEKFGEDYTAERLREIFSEFGKVEDVVIKSSKKKGSALVVMATKSAAGAATGSVCGNLSNPLLVLPLQPAVATQIPSAPKPVETESINNLVGAGYQAHEDAILEKLREKAKEKNKKKCC
ccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHcHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccEEEEEEccccccccHHHHHHHHcccccEEEEEEEccccccEEEEEEccHHHHHHHHHHHccccccccEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcc
ccHccccHHHHHccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEcccccccHHHHHHHHHHcccEEEEEEEccccccEEEEEEccHHHHHHHHHHHcccccccEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccc
mdvdhvdhyrvlglpsgeegakLTEKEISKAYKWKALelhpdkrpddpdahdnfQKLKSSYEILKDEKARKLFDDLLKIKREKQQRQSQQDGKRRKMMSDLEEREraafapdpavkaRQEEEKIARQLKEEIERIRAMHenkrtpaafasvketkqsgsggvgldkeKVLKVSWEKFGEDYTAERLREIFSEFGKVEDVVIKSSKKKGSALVVMATKSaagaatgsvcgnlsnpllvlplqpavatqipsapkpvetesiNNLVGAGYQAHEDAILEKLREKAKEKNKKKCC
mdvdhvdhyrvlglpsgeegaklteKEISKAYKWKALElhpdkrpddpdAHDNFQKLKSSYEILKDEKARKLFDDLLKIkrekqqrqsqqdgkrrkmMSDLEEreraafapdpavkarqeEEKIARQLKEEIERIRAmhenkrtpaafasvketkqsgsggvgldkekVLKVSWEKFGEDYTAERLREIFsefgkvedvviksskkkgsaLVVMATKSAAGAATGSVCGNLSNPLLVLPLQPAVATQIPSAPKPVETESINNLVGAGYQAHEDAILEKLREkakeknkkkcc
MDVDHVDHYRVLGLPSGEEGAKLTEKEISKAYKWKALELHPDKRPDDPDAHDNFQKLKSSYEILKDEKARKLFDDLLKIKREKQQRQSQQDGKRRKMMSDLEERERAAFAPDPAVKARQEEEKIARQLKEEIERIRAMHENKRTPAAFASVKETKQSGSGGVGLDKEKVLKVSWEKFGEDYTAERLREIFSEFGKVEDVVIKSSKKKGSALVVMatksaagaatgsVCGNLSNpllvlplqpavaTQIPSAPKPVETESINNLVGAGYQAHEDAILeklrekakeknkkkCC
*******************************YKW************************************************************************************************************************************EKVLKVSWEKFGEDYTAERLREIFSEFGKVEDVVIKSSKKKGSALVVMATKSAAGAATGSVCGNLSNPLLVLPLQPAVAT***************NLVGAGYQ***********************
***DHVDHYRVLGLPSGEEGAKLTEKEISKAYKWKALELHPDKRPDDPDAHDNFQKLKSSYEILKDEKARKLFDDLLKI********************************************************************************************VSWEKFGEDYTAERLREIFSEFGKVEDVVIKSSKKKGSALVVMATKSAAGAATGSVCGNLSNPLLVL**********************************DAILE***************
MDVDHVDHYRVLGLPSGEEGAKLTEKEISKAYKWKALELHPDKRPDDPDAHDNFQKLKSSYEILKDEKARKLFDDLLKIKR*****************************************KIARQLKEEIERIRAMHENKRTPAAFA************VGLDKEKVLKVSWEKFGEDYTAERLREIFSEFGKVEDVVIKSSKKKGSALVVMATKSAAGAATGSVCGNLSNPLLVLPLQPAVATQIPSAPKPVETESINNLVGAGYQAHEDAILEKLRE***********
*DVDHVDHYRVLGLPSGEEGAKLTEKEISKAYKWKALELHPDKRPDDPDAHDNFQKLKSSYEILKDEKARKLFDDLLKIKREKQQRQSQQDGKRRKMMSDLEERERAAFAPD***KARQEEEKIARQLKEEIERIRAMHENKRT*********************KEKVLKVSWEKFGEDYTAERLREIFSEFGKVEDVVIKSSKKKGSALVVMATKSAAGAATGSVCGNLSNPLLVLPLQP**************************QAHEDAILEKLREKAKEK*****C
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVDHVDHYRVLGLPSGEEGAKLTEKEISKAYKWKALELHPDKRPDDPDAHDNFQKLKSSYEILKDEKARKLFDDLLKIKREKQQRQSQQDGKRRKMMSDLEERERAAFAPDPxxxxxxxxxxxxxxxxxxxxxxxxxHENKRTPAAFASVKETKQSGSGGVGLDKEKVLKVSWEKFGEDYTAERLREIFSEFGKVEDVVIKSSKKKGSALVVMATKSAAGAATGSVCGNLSNPLLVLPLQPAVATQIPSAPKPVETESINNLVGAGYQAHEDAILEKLREKAKEKNKKKCC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query292 2.2.26 [Sep-21-2011]
Q2KI83304 DnaJ homolog subfamily C yes no 0.760 0.730 0.345 1e-20
Q9NVM6304 DnaJ homolog subfamily C yes no 0.760 0.730 0.337 2e-18
Q9P7C6289 Pre-mRNA-splicing factor yes no 0.732 0.740 0.297 2e-18
Q91WT4303 DnaJ homolog subfamily C yes no 0.773 0.745 0.329 2e-17
Q6TUG0358 DnaJ homolog subfamily B no no 0.215 0.175 0.455 2e-10
Q99KV1358 DnaJ homolog subfamily B no no 0.215 0.175 0.455 2e-10
Q5RAJ6358 DnaJ homolog subfamily B no no 0.215 0.175 0.455 2e-10
Q9UBS4358 DnaJ homolog subfamily B no no 0.215 0.175 0.455 2e-10
P81999358 DnaJ homolog subfamily B no no 0.215 0.175 0.455 3e-10
Q3ZBA6358 DnaJ homolog subfamily B no no 0.215 0.175 0.455 3e-10
>sp|Q2KI83|DJC17_BOVIN DnaJ homolog subfamily C member 17 OS=Bos taurus GN=DNAJC17 PE=2 SV=1 Back     alignment and function desciption
 Score =  100 bits (249), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 84/243 (34%), Positives = 131/243 (53%), Gaps = 21/243 (8%)

Query: 5   HVDHYRVLGLPSGEEGAKLTEKEISKAYKWKALELHPDKRPDDPDAHDNFQKLKSSYEIL 64
            +D Y +LG+   EE A+  +KE+ KAY+ KAL  HPDK PD+P A + F +L  + E+L
Sbjct: 9   QMDLYALLGI---EEKAE--DKEVKKAYRQKALSCHPDKNPDNPRAAELFHQLSQALEVL 63

Query: 65  KDEKARKLFDDLLKIKREKQQRQSQQDGKRRKMMSDLEERERAAFAPDPAVKARQEEEKI 124
            D  AR  +D + K K++  +R  + D +R+K+  DLE RER A A        +EE   
Sbjct: 64  TDAAARAAYDKVRKAKKQAAERTQKLDERRKKVKLDLEARERQAQA---LGSEEEEESGS 120

Query: 125 ARQLKEEIERI-----RAMHENKR-TPAAFASVKETKQSGSGGVGLDKEKVLKVSWEKFG 178
           AR L++EIER+     R + E +R         +E + +G      +KE        K  
Sbjct: 121 ARTLEQEIERLREEGSRQLEEQQRLIREQIRQEQEQRLTGMAKNPENKETPKLKLKWKSK 180

Query: 179 ED------YTAERLREIFSEFGKVEDVVIKSSKKKGSALVVMATKSAAGAATGSVCGNLS 232
           ++      Y+ + L ++F ++G+V ++V+ SSKK G+A+V  AT  AA  A  +  G + 
Sbjct: 181 KEAESQGGYSRDVLLQLFQKYGEVLNLVL-SSKKAGTAVVEFATVKAAELAVQNEVGLVD 239

Query: 233 NPL 235
           NPL
Sbjct: 240 NPL 242





Bos taurus (taxid: 9913)
>sp|Q9NVM6|DJC17_HUMAN DnaJ homolog subfamily C member 17 OS=Homo sapiens GN=DNAJC17 PE=1 SV=1 Back     alignment and function description
>sp|Q9P7C6|CWC23_SCHPO Pre-mRNA-splicing factor cwf23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf23 PE=1 SV=2 Back     alignment and function description
>sp|Q91WT4|DJC17_MOUSE DnaJ homolog subfamily C member 17 OS=Mus musculus GN=Dnajc17 PE=2 SV=2 Back     alignment and function description
>sp|Q6TUG0|DJB11_RAT DnaJ homolog subfamily B member 11 OS=Rattus norvegicus GN=Dnajb11 PE=2 SV=1 Back     alignment and function description
>sp|Q99KV1|DJB11_MOUSE DnaJ homolog subfamily B member 11 OS=Mus musculus GN=Dnajb11 PE=1 SV=1 Back     alignment and function description
>sp|Q5RAJ6|DJB11_PONAB DnaJ homolog subfamily B member 11 OS=Pongo abelii GN=DNAJB11 PE=2 SV=1 Back     alignment and function description
>sp|Q9UBS4|DJB11_HUMAN DnaJ homolog subfamily B member 11 OS=Homo sapiens GN=DNAJB11 PE=1 SV=1 Back     alignment and function description
>sp|P81999|DJB11_CANFA DnaJ homolog subfamily B member 11 OS=Canis familiaris GN=DNAJB11 PE=1 SV=2 Back     alignment and function description
>sp|Q3ZBA6|DJB11_BOVIN DnaJ homolog subfamily B member 11 OS=Bos taurus GN=DNAJB11 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query292
225429187286 PREDICTED: dnaJ homolog subfamily C memb 0.972 0.993 0.7 1e-107
297736401341 unnamed protein product [Vitis vinifera] 0.972 0.832 0.7 1e-107
255563542289 Pre-mRNA-splicing factor cwc23, putative 0.986 0.996 0.693 1e-106
449454237290 PREDICTED: dnaJ homolog subfamily C memb 0.969 0.975 0.685 1e-106
449508808290 PREDICTED: LOW QUALITY PROTEIN: dnaJ hom 0.969 0.975 0.681 1e-105
356575456284 PREDICTED: dnaJ homolog subfamily C memb 0.958 0.985 0.692 1e-103
30689058296 DNAJ heat shock N-terminal domain-contai 0.972 0.959 0.655 1e-101
356536396287 PREDICTED: dnaJ homolog subfamily C memb 0.965 0.982 0.679 1e-100
8809700349 unnamed protein product [Arabidopsis tha 0.938 0.785 0.671 1e-100
297812513302 DNAJ heat shock N-terminal domain-contai 0.972 0.940 0.641 8e-99
>gi|225429187|ref|XP_002275857.1| PREDICTED: dnaJ homolog subfamily C member 17-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 203/290 (70%), Positives = 243/290 (83%), Gaps = 6/290 (2%)

Query: 1   MDVDHVDHYRVLGLPSGEEGAKLTEKEISKAYKWKALELHPDKRPDDPDAHDNFQKLKSS 60
           MD++ VDHY VLGLPSGEEGAKL+EKEISKAY+ KALELHPDKRPDDP AH NFQKLK+S
Sbjct: 1   MDMN-VDHYNVLGLPSGEEGAKLSEKEISKAYRVKALELHPDKRPDDPQAHANFQKLKTS 59

Query: 61  YEILKDEKARKLFDDLLKIKREKQQRQSQQDGKRRKMMSDLEERERAAFAPDPAVKARQE 120
           YEILKDEKARKLFDDLL++KRE+  RQ+Q D KRR+M+SDLEERERAA APDPA KAR+E
Sbjct: 60  YEILKDEKARKLFDDLLRVKREQFHRQAQYDVKRRRMVSDLEERERAANAPDPASKAREE 119

Query: 121 EEKIARQLKEEIERIRAMHENKRTPAAFASVKETKQS--GSGGVGLDKEKVLKVSWEKFG 178
           EE+I ++LKEEI RIRAMH NK    +      T++     GG GL+KEKVLKVSWEK G
Sbjct: 120 EERITKKLKEEIARIRAMHANKGASGSRKEAPGTRKESVADGGGGLNKEKVLKVSWEKGG 179

Query: 179 EDYTAERLREIFSEFGKVEDVVIKSSKKKGSALVVMATKSAAGAATGSVCGNLSNPLLVL 238
           EDYTAE LRE+F++FG+VEDVV+KSS+KKGSALVVMA+K AA AATG+VCG++SNPLLVL
Sbjct: 180 EDYTAEGLREVFAKFGEVEDVVLKSSRKKGSALVVMASKEAAVAATGNVCGHISNPLLVL 239

Query: 239 PLQPAVATQIPSAPKPVETESINNLVGAGYQAHEDAILEKLREKAKEKNK 288
           PL+PAV  + P  P+ +E E  +NLVGAGYQ+ E+++L+KL +KA EK K
Sbjct: 240 PLEPAVVMEFP--PRSMEPEPSSNLVGAGYQSFEESVLKKL-QKAAEKQK 286




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297736401|emb|CBI25124.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255563542|ref|XP_002522773.1| Pre-mRNA-splicing factor cwc23, putative [Ricinus communis] gi|223538011|gb|EEF39624.1| Pre-mRNA-splicing factor cwc23, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449454237|ref|XP_004144862.1| PREDICTED: dnaJ homolog subfamily C member 17-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449508808|ref|XP_004163417.1| PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog subfamily C member 17-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356575456|ref|XP_003555857.1| PREDICTED: dnaJ homolog subfamily C member 17-like [Glycine max] Back     alignment and taxonomy information
>gi|30689058|ref|NP_197749.2| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gi|79328547|ref|NP_001031930.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gi|22135988|gb|AAM91576.1| putative protein [Arabidopsis thaliana] gi|30023808|gb|AAP13437.1| At5g23590 [Arabidopsis thaliana] gi|332005804|gb|AED93187.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gi|332005805|gb|AED93188.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356536396|ref|XP_003536724.1| PREDICTED: dnaJ homolog subfamily C member 17-like [Glycine max] Back     alignment and taxonomy information
>gi|8809700|dbj|BAA97241.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297812513|ref|XP_002874140.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297319977|gb|EFH50399.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query292
TAIR|locus:2171736296 AT5G23590 [Arabidopsis thalian 0.928 0.915 0.620 1.7e-84
UNIPROTKB|E1C0R0304 DNAJC17 "Uncharacterized prote 0.684 0.657 0.364 2.2e-25
FB|FBgn0037882299 CG17187 [Drosophila melanogast 0.640 0.625 0.368 2.9e-25
UNIPROTKB|Q2KI83304 DNAJC17 "DnaJ homolog subfamil 0.674 0.648 0.363 4.6e-25
ZFIN|ZDB-GENE-040426-894307 dnajc17 "DnaJ (Hsp40) homolog, 0.667 0.635 0.369 9.7e-25
UNIPROTKB|E2RGH7304 DNAJC17 "Uncharacterized prote 0.678 0.651 0.351 1.2e-24
UNIPROTKB|Q9NVM6304 DNAJC17 "DnaJ homolog subfamil 0.667 0.641 0.351 2e-24
UNIPROTKB|F1SST1304 DNAJC17 "Uncharacterized prote 0.671 0.644 0.325 4.8e-23
MGI|MGI:1916658303 Dnajc17 "DnaJ (Hsp40) homolog, 0.667 0.643 0.342 2.1e-22
RGD|1308015303 Dnajc17 "DnaJ (Hsp40) homolog, 0.667 0.643 0.337 2.6e-22
TAIR|locus:2171736 AT5G23590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 846 (302.9 bits), Expect = 1.7e-84, P = 1.7e-84
 Identities = 172/277 (62%), Positives = 209/277 (75%)

Query:     6 VDHYRVLGLPSGEEGAKLTEKEISKAYKWKALELHPDKRPDDPDAHDNFQKLKSSYEILK 65
             VDHY VLGL SGEE  KLTEKEI+KAYK KAL+LHPDKRPDDPDAH+ FQ+LK+SYE+LK
Sbjct:     5 VDHYIVLGLASGEEALKLTEKEIAKAYKLKALDLHPDKRPDDPDAHEKFQRLKTSYEVLK 64

Query:    66 DEKARKLFDDLLKIKREKQQRQSQQDGKRRKMMSDLEERERAAFAPDPAVKARQEEEKIA 125
             DEKARKLFDDLL+I+REKQ ++SQ D KRRKMMSDLEERER+AF+P+P+ +A  EEE+IA
Sbjct:    65 DEKARKLFDDLLRIQREKQHKKSQVDSKRRKMMSDLEERERSAFSPNPSARAYDEEERIA 124

Query:   126 RQLKEEIERIRAMHENKR----TPAAFASVKETKQ-SGSGG-VGLDKEKVLKVSWEKFGE 179
             R+LKEEI+RIRA H  K+    TP +    K  ++ SG+G  V LDKE++LKVSWEK GE
Sbjct:   125 RKLKEEIDRIRARHAKKKSGFQTPESNVDEKRKEERSGAGASVQLDKERMLKVSWEKSGE 184

Query:   180 DYTAERLREIFSEFGKVEDVVIKSSKKKGSALVVMXXXXXXXXXXXXVCGNLSNXXXXXX 239
              YTA RLRE+FSEFG+VEDVVI+S+KKK SAL+VM            +CGNLSN      
Sbjct:   185 GYTAGRLREVFSEFGEVEDVVIRSTKKKCSALIVMATKDGAVAATRTLCGNLSNPLLVVP 244

Query:   240 XXXXXXTQIPSAPKPVETESINNLVGAGYQAHEDAIL 276
                   T   +A K  E E  +N+VGAG QA+EDA++
Sbjct:   245 LQKAAQTDFLTAKKSAEAEPQSNIVGAGLQAYEDAVM 281




GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
UNIPROTKB|E1C0R0 DNAJC17 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0037882 CG17187 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KI83 DNAJC17 "DnaJ homolog subfamily C member 17" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-894 dnajc17 "DnaJ (Hsp40) homolog, subfamily C, member 17" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RGH7 DNAJC17 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NVM6 DNAJC17 "DnaJ homolog subfamily C member 17" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SST1 DNAJC17 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1916658 Dnajc17 "DnaJ (Hsp40) homolog, subfamily C, member 17" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308015 Dnajc17 "DnaJ (Hsp40) homolog, subfamily C, member 17" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00038614001
SubName- Full=Chromosome chr3 scaffold_95, whole genome shotgun sequence; (338 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query292
cd1242974 cd12429, RRM_DNAJC17, RNA recognition motif in the 3e-24
pfam0022663 pfam00226, DnaJ, DnaJ domain 3e-16
COG0484371 COG0484, DnaJ, DnaJ-class molecular chaperone with 7e-14
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 8e-14
PRK10767371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 3e-12
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 7e-12
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 3e-11
TIGR02349354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 4e-11
PRK14301373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 5e-11
PRK14295389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 1e-10
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 4e-10
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 7e-10
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 7e-09
PRK14289386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 7e-09
PRK14277386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 2e-08
PRK14294366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 2e-08
PRK14278378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 3e-08
PRK14297380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 1e-07
PRK14291382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 2e-07
PRK14298377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 4e-07
PRK14283378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 7e-07
PRK14285365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 1e-06
PRK14290365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 3e-06
PRK14286372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 3e-06
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 5e-06
smart0036073 smart00360, RRM, RNA recognition motif 6e-06
PRK14282369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 6e-06
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 7e-06
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 8e-06
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 9e-06
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 2e-05
PRK14280376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 3e-05
pfam0007670 pfam00076, RRM_1, RNA recognition motif 5e-05
PRK14300372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 6e-05
PRK14292371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 8e-05
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 8e-05
PRK14276380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 1e-04
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 1e-04
PRK14288369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 2e-04
PRK14296372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 2e-04
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 2e-04
pfam1389356 pfam13893, RRM_5, RNA recognition motif 2e-04
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 5e-04
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 0.001
PRK14287371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 0.001
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 0.002
cd1225772 cd12257, RRM1_RBM26_like, RNA recognition motif 1 0.003
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 0.004
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 0.004
>gnl|CDD|240875 cd12429, RRM_DNAJC17, RNA recognition motif in the DnaJ homolog subfamily C member 17 Back     alignment and domain information
 Score = 92.7 bits (231), Expect = 3e-24
 Identities = 41/75 (54%), Positives = 52/75 (69%), Gaps = 3/75 (4%)

Query: 168 KVLKVSW--EKFGEDYTAERLREIFSEFGKVEDVVIKSSKKKGSALVVMATKSAAGAATG 225
           + LKV W  +K   DY+ + LR+IFS++G V DVV+ SSKKKGSA+V  A+K AA AA  
Sbjct: 1   RRLKVKWKRKKGNGDYSEDELRKIFSKYGDVSDVVV-SSKKKGSAIVEFASKKAAEAAVE 59

Query: 226 SVCGNLSNPLLVLPL 240
           + CG  SNPLLV  L
Sbjct: 60  NECGLPSNPLLVSWL 74


The CD corresponds to the RRM of some eukaryotic DnaJ homolog subfamily C member 17 and similar proteins. DnaJ/Hsp40 (heat shock protein 40) proteins are highly conserved and play crucial roles in protein translation, folding, unfolding, translocation, and degradation. They act primarily by stimulating the ATPase activity of Hsp70s, an important chaperonine family. Members in this family contains an N-terminal DnaJ domain or J-domain, which mediates the interaction with Hsp70. They also contains a RNA recognition motif (RRM), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), at the C-terminus, which may play an essential role in RNA binding. . Length = 74

>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240703 cd12257, RRM1_RBM26_like, RNA recognition motif 1 in vertebrate RNA-binding protein 26 (RBM26) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 292
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 99.95
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 99.87
KOG0713336 consensus Molecular chaperone (DnaJ superfamily) [ 99.87
PRK14288369 chaperone protein DnaJ; Provisional 99.77
PRK14279 392 chaperone protein DnaJ; Provisional 99.75
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.74
PRK14296372 chaperone protein DnaJ; Provisional 99.74
KOG0712337 consensus Molecular chaperone (DnaJ superfamily) [ 99.73
PRK14286372 chaperone protein DnaJ; Provisional 99.73
PRK14277386 chaperone protein DnaJ; Provisional 99.7
PRK14285365 chaperone protein DnaJ; Provisional 99.7
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.7
PRK14295389 chaperone protein DnaJ; Provisional 99.69
PRK14282369 chaperone protein DnaJ; Provisional 99.69
PRK14294366 chaperone protein DnaJ; Provisional 99.69
PRK14301373 chaperone protein DnaJ; Provisional 99.69
PRK14297380 chaperone protein DnaJ; Provisional 99.69
PRK14287371 chaperone protein DnaJ; Provisional 99.68
PRK14283378 chaperone protein DnaJ; Provisional 99.68
PRK14284 391 chaperone protein DnaJ; Provisional 99.68
PRK14276380 chaperone protein DnaJ; Provisional 99.68
PRK10767371 chaperone protein DnaJ; Provisional 99.68
PRK14299291 chaperone protein DnaJ; Provisional 99.68
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.68
PRK14278378 chaperone protein DnaJ; Provisional 99.67
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.67
PRK14291382 chaperone protein DnaJ; Provisional 99.67
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.67
PRK14281 397 chaperone protein DnaJ; Provisional 99.67
PRK14298377 chaperone protein DnaJ; Provisional 99.66
PRK14280376 chaperone protein DnaJ; Provisional 99.66
PRK14289386 chaperone protein DnaJ; Provisional 99.65
PRK14290365 chaperone protein DnaJ; Provisional 99.63
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 99.61
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.61
PRK14300372 chaperone protein DnaJ; Provisional 99.61
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.6
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.6
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.6
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.6
PRK14292371 chaperone protein DnaJ; Provisional 99.6
PRK14293374 chaperone protein DnaJ; Provisional 99.59
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.58
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.56
PRK05014171 hscB co-chaperone HscB; Provisional 99.55
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.53
PRK00294173 hscB co-chaperone HscB; Provisional 99.5
PRK03578176 hscB co-chaperone HscB; Provisional 99.49
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 99.49
PRK01356166 hscB co-chaperone HscB; Provisional 99.47
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.44
PHA03102153 Small T antigen; Reviewed 99.4
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.4
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 99.32
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.24
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 99.14
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.13
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.12
PTZ00100116 DnaJ chaperone protein; Provisional 99.1
PRK01773173 hscB co-chaperone HscB; Provisional 99.08
PHA02624 647 large T antigen; Provisional 99.0
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.99
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 98.93
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.91
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.9
KOG0122270 consensus Translation initiation factor 3, subunit 98.74
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 98.71
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 98.57
PLN03120 260 nucleic acid binding protein; Provisional 98.55
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 98.52
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 98.49
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 98.47
KOG0114124 consensus Predicted RNA-binding protein (RRM super 98.46
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 98.42
smart0036071 RRM RNA recognition motif. 98.36
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 98.35
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 98.33
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 98.3
PLN03121 243 nucleic acid binding protein; Provisional 98.29
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 98.23
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.23
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 98.23
KOG0149 247 consensus Predicted RNA-binding protein SEB4 (RRM 98.21
KOG4207 256 consensus Predicted splicing factor, SR protein su 98.21
smart0036170 RRM_1 RNA recognition motif. 98.21
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 98.18
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 98.17
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 98.17
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 98.17
smart0036272 RRM_2 RNA recognition motif. 98.16
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 98.15
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.14
KOG0125 376 consensus Ataxin 2-binding protein (RRM superfamil 98.09
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 98.09
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 98.03
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 98.03
KOG0105 241 consensus Alternative splicing factor ASF/SF2 (RRM 98.01
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 98.0
KOG0113 335 consensus U1 small nuclear ribonucleoprotein (RRM 98.0
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 97.98
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 97.96
PF15023166 DUF4523: Protein of unknown function (DUF4523) 97.93
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 97.92
COG0724306 RNA-binding proteins (RRM domain) [General functio 97.87
KOG0121153 consensus Nuclear cap-binding protein complex, sub 97.82
KOG0111 298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 97.78
PLN03213 759 repressor of silencing 3; Provisional 97.78
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 97.77
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.77
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 97.76
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 97.69
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 97.67
KOG0145 360 consensus RNA-binding protein ELAV/HU (RRM superfa 97.67
KOG0148 321 consensus Apoptosis-promoting RNA-binding protein 97.66
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 97.53
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 97.47
KOG0147 549 consensus Transcriptional coactivator CAPER (RRM s 97.45
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 97.42
KOG0146 371 consensus RNA-binding protein ETR-3 (RRM superfami 97.42
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 97.38
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 97.36
KOG0153377 consensus Predicted RNA-binding protein (RRM super 97.27
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 97.24
KOG0126219 consensus Predicted RNA-binding protein (RRM super 97.23
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 97.19
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 97.17
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 97.13
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 97.07
KOG0415 479 consensus Predicted peptidyl prolyl cis-trans isom 97.0
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 96.99
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 96.79
KOG0533243 consensus RRM motif-containing protein [RNA proces 96.67
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 96.62
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 96.55
KOG0431453 consensus Auxilin-like protein and related protein 96.48
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 96.35
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 96.24
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 96.23
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 96.17
KOG1456 494 consensus Heterogeneous nuclear ribonucleoprotein 96.07
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 96.06
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 95.97
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 95.95
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 95.87
KOG2314 698 consensus Translation initiation factor 3, subunit 95.71
KOG4205 311 consensus RNA-binding protein musashi/mRNA cleavag 95.67
KOG4660 549 consensus Protein Mei2, essential for commitment t 95.52
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 95.4
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 95.39
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 95.36
KOG0151 877 consensus Predicted splicing regulator, contains R 95.33
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 95.23
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 95.21
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 94.83
KOG4454 267 consensus RNA binding protein (RRM superfamily) [G 94.81
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 94.56
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 94.34
KOG2135526 consensus Proteins containing the RNA recognition 94.3
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 94.27
KOG0147 549 consensus Transcriptional coactivator CAPER (RRM s 94.19
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 93.07
KOG1548382 consensus Transcription elongation factor TAT-SF1 92.38
KOG1457284 consensus RNA binding protein (contains RRM repeat 91.63
KOG1855 484 consensus Predicted RNA-binding protein [General f 91.61
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 90.81
KOG1190 492 consensus Polypyrimidine tract-binding protein [RN 90.19
KOG0226290 consensus RNA-binding proteins [General function p 90.11
KOG0115 275 consensus RNA-binding protein p54nrb (RRM superfam 89.54
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 89.38
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 88.99
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 88.4
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 87.44
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 83.22
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 82.69
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 81.39
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 80.55
COG5175 480 MOT2 Transcriptional repressor [Transcription] 80.49
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.95  E-value=1.6e-28  Score=227.32  Aligned_cols=265  Identities=27%  Similarity=0.336  Sum_probs=169.2

Q ss_pred             CCcccccccccccCCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChhHHHHHHHHHHHHHHccCchhhhhHHHHHHHHHHH
Q 022759            4 DHVDHYRVLGLPSGEEGAKLTEKEISKAYKWKALELHPDKRPDDPDAHDNFQKLKSSYEILKDEKARKLFDDLLKIKREK   83 (292)
Q Consensus         4 ~~~d~Y~iLgv~~~~~~~~a~~~eIkkaYrk~al~~HPDk~~~~~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~~~~~~~~   83 (292)
                      .+.|||+||||+.+     ++..+|++|||.+|++|||||||+||.|.+.|+.|.+||+||+|+.+|..||.+++.....
T Consensus         3 ~~~dyY~lLgi~~~-----at~~eIkKaYr~kaL~~HPDKNp~dP~A~ekFq~L~eAy~VL~D~~~R~~YDk~~k~~~~~   77 (296)
T KOG0691|consen    3 KDTDYYDLLGISED-----ATDAEIKKAYRKKALQYHPDKNPGDPQAAEKFQELSEAYEVLSDEESRAAYDKLRKSGSSA   77 (296)
T ss_pred             ccchHHHHhCCCCC-----CCHHHHHHHHHHHHHhcCCCCCCCChHHHHHHHHHHHHHHHhcCHHHHHHHHHHhhhcccc
Confidence            47899999999998     9999999999999999999999999999999999999999999999999999999999888


Q ss_pred             HHHHhhhhhHHHHHHHHHHHHHHHhcCCChHHHHHHHHHHHHHHHHHHHHHHHHhhhhccCh-----hhhhhhhhhhcCC
Q 022759           84 QQRQSQQDGKRRKMMSDLEERERAAFAPDPAVKARQEEEKIARQLKEEIERIRAMHENKRTP-----AAFASVKETKQSG  158 (292)
Q Consensus        84 ~~r~~~~~~kr~~~~~dLe~RE~~~~~~~~~~~~~~~~~~~~~~l~eE~~r~r~~~~~~~~~-----~~~~~~~~~~~~~  158 (292)
                      ..+..+.+..|..+..|+++++..+.+..........+ .  ..+.+++...+++...++..     ........  .  
T Consensus        78 ~~~~d~~~~~r~~f~~dl~~~~~~~~a~~~~~~e~~~e-~--~~~~~k~~~~~~er~~~l~~~~~~~l~~~~~~~--~--  150 (296)
T KOG0691|consen   78 QGREDQADGFRKKFGSDLFERERGALALLKESEESELE-R--ERLQEKFRAVQRERVDKLVEILREKLSEVVESV--E--  150 (296)
T ss_pred             hhhhhHHHHHHHHhhhhhhhhHHHHHhHHhhhhhhhhh-H--HHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhh--h--
Confidence            89999999999999999999999866644331000000 0  01111221221111111000     00000000  0  


Q ss_pred             CCCCCCC----ccceEEEEeee-cCCCCCHHHHHHHhcccCCeeEEEEec--CCCcce---EEEEecCHHHHHHHHHhhc
Q 022759          159 SGGVGLD----KEKVLKVSWEK-FGEDYTAERLREIFSEFGKVEDVVIKS--SKKKGS---ALVVMATKSAAGAATGSVC  228 (292)
Q Consensus       159 ~~~~~~~----~~~~lkvKWk~-~~~~~t~~~L~~~fs~yG~V~~v~i~~--~k~~g~---A~V~F~~~~~A~~Av~~~~  228 (292)
                      ...-.+.    ....+...|-. .+..|+. .....|++|+.+..|....  .+.+|-   +.+.+++...+.....++.
T Consensus       151 ~~~~~~e~~~l~~e~~~~e~~~~~g~~y~~-~~~~~~~~~~~~~~v~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~e~  229 (296)
T KOG0691|consen  151 ERKLATEALQLQRERFGEELLHTIGRTYSR-TKALKPIKFRTSPGVSKLSEGSRAKGGALRAMWNLAAGAVALYGGQDEM  229 (296)
T ss_pred             hhhhhHHHHHHHHhhhhHHHHHhhcccchh-hHhhhccccccccCcchhhhcccccchhHHHHHhhhHHHHHHHHHHHHH
Confidence            0000000    00112222222 4445665 6777777777655555432  333332   3456666666666667788


Q ss_pred             CCCCCCeEEEecCCCccCCCCCCCCCCCccccCcCCCcChHhHHHHHHHHHH--hHHHHHh
Q 022759          229 GNLSNPLLVLPLQPAVATQIPSAPKPVETESINNLVGAGYQAHEDAILEKLR--EKAKEKN  287 (292)
Q Consensus       229 g~~~~pl~v~~~~~~~~~~~p~~~~~~~~~~~s~~~~~s~~d~E~~vl~rlr--~a~erk~  287 (292)
                      +.+.+|+.+.|..++   ..+.  ..+ ....+++.+++..|+|+.+++.++  ++.+..+
T Consensus       230 ~~~~~~~~~~~e~~~---~~~~--~~~-~~~~~~~~~~s~~dies~l~~~~~~~~d~~v~~  284 (296)
T KOG0691|consen  230 EKLLEALGEALEKRA---EYAS--AKT-GKSLDTLWHGSSFDIESTLIRVCQKIKDPSVPL  284 (296)
T ss_pred             HhhhcchHHHhhhch---HHHH--Hhh-cchhhhhhHhHHHHHHHHHHHHHHHhcChHHHH
Confidence            899999888887631   0100  001 111233456789999999999999  6555544



>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query292
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 1e-09
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 1e-09
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 9e-09
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 1e-07
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-07
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 3e-07
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 4e-07
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 6e-07
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 9e-07
2ctq_A112 Solution Structure Of J-Domain From Human Dnaj Subf 1e-06
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 5e-06
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 5e-06
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 7e-06
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 8e-06
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 1e-05
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 3e-05
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 1e-04
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure

Iteration: 1

Score = 60.5 bits (145), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 29/68 (42%), Positives = 45/68 (66%), Gaps = 5/68 (7%) Query: 7 DHYRVLGLPSGEEGAKLTEKEISKAYKWKALELHPDKRPDDPDAHDNFQKLKSSYEILKD 66 + Y +LG+ + +EI +A+K AL+LHPDK P++P+AH +F K+ +YE+LKD Sbjct: 22 NFYSLLGV-----SKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKD 76 Query: 67 EKARKLFD 74 E RK +D Sbjct: 77 EDLRKKYD 84
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query292
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 2e-17
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 6e-16
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 4e-14
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 1e-13
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 3e-13
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 4e-13
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 1e-12
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 1e-12
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 2e-12
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 3e-12
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 1e-11
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 2e-11
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 3e-11
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 4e-11
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 4e-11
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 5e-11
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 1e-10
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 2e-10
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 3e-10
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 3e-10
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 4e-10
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 4e-10
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 6e-10
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 8e-10
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 4e-09
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 8e-09
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 6e-07
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 6e-07
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 7e-07
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 1e-06
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 2e-06
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 5e-06
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 7e-06
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 7e-06
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 7e-06
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 9e-06
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 2e-04
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 1e-05
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-05
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-04
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 1e-05
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-05
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 1e-05
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 2e-05
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 2e-05
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 2e-05
1x5p_A97 Negative elongation factor E; structure genomics, 3e-05
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 3e-05
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 3e-05
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 3e-05
2kt5_A124 RNA and export factor-binding protein 2; chaperone 4e-05
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 4e-05
2cpj_A99 Non-POU domain-containing octamer-binding protein; 4e-05
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 5e-05
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 5e-05
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 5e-05
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 5e-05
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 5e-05
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 5e-05
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 5e-05
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 6e-05
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 6e-05
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 6e-05
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 6e-05
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 7e-05
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 8e-05
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 9e-05
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 9e-05
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 5e-04
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 9e-05
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 1e-04
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 1e-04
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 1e-04
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 1e-04
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 1e-04
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 1e-04
2f3j_A177 RNA and export factor binding protein 2; RRM domai 2e-04
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-04
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 4e-04
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 2e-04
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 2e-04
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 2e-04
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-04
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 2e-04
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-04
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 3e-04
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 3e-04
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-04
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 3e-04
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 3e-04
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 3e-04
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 4e-04
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 4e-04
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 4e-04
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 4e-04
2cph_A107 RNA binding motif protein 19; RNA recognition moti 4e-04
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 4e-04
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 4e-04
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 4e-04
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 4e-04
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 4e-04
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 4e-04
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 4e-04
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 5e-04
2guz_A71 Mitochondrial import inner membrane translocase su 5e-04
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 5e-04
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 5e-04
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 6e-04
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 6e-04
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 6e-04
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 6e-04
1x4e_A85 RNA binding motif, single-stranded interacting pro 6e-04
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 6e-04
2cqd_A116 RNA-binding region containing protein 1; RNA recog 6e-04
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 7e-04
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 7e-04
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 7e-04
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 7e-04
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 8e-04
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 9e-04
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 9e-04
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 9e-04
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 9e-04
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
 Score = 78.4 bits (193), Expect = 2e-17
 Identities = 29/68 (42%), Positives = 45/68 (66%), Gaps = 5/68 (7%)

Query: 7  DHYRVLGLPSGEEGAKLTEKEISKAYKWKALELHPDKRPDDPDAHDNFQKLKSSYEILKD 66
          + Y +LG+         + +EI +A+K  AL+LHPDK P++P+AH +F K+  +YE+LKD
Sbjct: 3  NFYSLLGVSKTA-----SSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKD 57

Query: 67 EKARKLFD 74
          E  RK +D
Sbjct: 58 EDLRKKYD 65


>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query292
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.8
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.79
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.79
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.79
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.78
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.78
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.77
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.77
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.76
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.76
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.76
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.75
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.75
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.74
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.74
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.73
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.72
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.72
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.71
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.7
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.69
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.65
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.63
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.63
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.62
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.62
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.62
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 99.59
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.59
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.58
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.54
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.54
2guz_A71 Mitochondrial import inner membrane translocase su 99.51
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.44
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.08
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.08
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.07
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.07
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.06
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.04
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.03
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.02
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.02
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.01
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.0
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.0
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 98.99
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 98.98
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 98.98
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 98.98
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 98.98
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 98.98
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 98.98
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 98.97
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 98.97
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.96
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 98.96
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 98.96
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 98.95
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 98.95
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 98.95
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 98.95
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 98.95
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 98.94
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 98.93
1x5p_A97 Negative elongation factor E; structure genomics, 98.93
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 98.93
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 98.93
2cph_A107 RNA binding motif protein 19; RNA recognition moti 98.93
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 98.93
3p5t_L90 Cleavage and polyadenylation specificity factor S; 98.93
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 98.93
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 98.92
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 98.92
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 98.92
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 98.92
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 98.91
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 98.91
2dis_A109 Unnamed protein product; structural genomics, RRM 98.91
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 98.9
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.9
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 98.9
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 98.9
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 98.9
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 98.9
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.89
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 98.89
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 98.89
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 98.89
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 98.89
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 98.88
2cpj_A99 Non-POU domain-containing octamer-binding protein; 98.88
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 98.88
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 98.87
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 98.87
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 98.87
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.87
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 98.87
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 98.87
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 98.87
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 98.87
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 98.87
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 98.86
1x5o_A114 RNA binding motif, single-stranded interacting pro 98.86
2kt5_A124 RNA and export factor-binding protein 2; chaperone 98.86
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 98.86
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 98.86
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 98.86
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.86
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 98.86
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 98.85
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 98.85
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 98.85
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 98.84
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 98.84
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 98.84
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 98.83
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 98.83
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 98.83
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 98.83
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 98.83
2krb_A81 Eukaryotic translation initiation factor 3 subunit 98.83
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.83
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 98.82
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 98.82
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 98.82
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 98.82
2la6_A99 RNA-binding protein FUS; structural genomics, nort 98.82
2dit_A112 HIV TAT specific factor 1 variant; structural geno 98.81
2i2y_A150 Fusion protein consists of immunoglobin G- binding 98.81
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 98.81
2cqd_A116 RNA-binding region containing protein 1; RNA recog 98.8
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 98.8
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 98.8
2div_A99 TRNA selenocysteine associated protein; structural 98.8
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 98.8
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 98.8
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 98.8
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 98.79
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 98.79
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 98.79
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 98.79
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 98.78
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 98.78
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 98.78
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 98.78
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 98.78
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 98.78
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 98.77
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 98.76
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 98.76
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 98.76
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 98.75
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 98.75
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 98.73
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 98.73
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 98.73
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 98.73
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 98.73
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 98.73
1x4e_A85 RNA binding motif, single-stranded interacting pro 98.72
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 98.72
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 98.71
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 98.71
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 98.71
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 98.7
2f3j_A177 RNA and export factor binding protein 2; RRM domai 98.7
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 98.7
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.69
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 98.68
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 98.68
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 98.67
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 98.67
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 98.66
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 98.65
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 98.65
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 98.64
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 98.64
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 98.64
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 98.64
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.63
3n9u_C156 Cleavage and polyadenylation specificity factor S; 98.63
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 98.63
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 98.62
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 98.62
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 98.62
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 98.61
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 98.61
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.61
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 98.61
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 98.6
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 98.6
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 98.6
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 98.59
2dnl_A114 Cytoplasmic polyadenylation element binding protei 98.59
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 98.59
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 98.58
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 98.57
3q2s_C229 Cleavage and polyadenylation specificity factor S; 98.57
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 98.56
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 98.56
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 98.55
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 98.54
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 98.54
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 98.52
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 98.52
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 98.52
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 98.52
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 98.5
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 98.5
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 98.5
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 98.5
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.49
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 98.49
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 98.48
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 98.48
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 97.85
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.46
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 98.46
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 98.45
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 98.44
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 98.43
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 98.43
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 98.43
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 98.43
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 98.4
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 98.37
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 98.37
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 98.36
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 98.34
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 98.34
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 98.33
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 98.33
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 98.32
2guz_B65 Mitochondrial import inner membrane translocase su 98.3
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 98.28
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 98.13
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 98.08
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 98.05
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 97.81
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 97.81
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 97.74
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 97.41
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 95.07
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 94.73
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 94.12
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 93.24
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 91.42
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 91.39
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 85.84
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 85.24
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=99.80  E-value=4.8e-20  Score=138.43  Aligned_cols=70  Identities=41%  Similarity=0.675  Sum_probs=65.9

Q ss_pred             CCCcccccccccccCCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChhHHHHHHHHHHHHHHccCchhhhhHHHHH
Q 022759            3 VDHVDHYRVLGLPSGEEGAKLTEKEISKAYKWKALELHPDKRPDDPDAHDNFQKLKSSYEILKDEKARKLFDDLL   77 (292)
Q Consensus         3 ~~~~d~Y~iLgv~~~~~~~~a~~~eIkkaYrk~al~~HPDk~~~~~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~~   77 (292)
                      ....|||+||||+++     ++..+|+++||+++++||||++++++.+.+.|+.|++||++|+||.+|..||.++
T Consensus         4 ~~~~~~y~iLgv~~~-----a~~~~Ik~ayr~l~~~~HPD~~~~~~~a~~~f~~i~~Ay~~L~d~~~R~~YD~~g   73 (79)
T 2dn9_A            4 GSSGDYYQILGVPRN-----ASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYG   73 (79)
T ss_dssp             SCCSCHHHHHTCCTT-----CCHHHHHHHHHHHHHHTCTTTCSSCTTHHHHHHHHHHHHHHHHSHHHHHHHHHSC
T ss_pred             CCCCCHHHHcCCCCC-----CCHHHHHHHHHHHHHHHCcCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHhcc
Confidence            356799999999997     8999999999999999999999988899999999999999999999999999864



>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 292
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 7e-11
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 1e-09
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 2e-09
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 4e-09
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 1e-08
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 3e-08
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 8e-08
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 8e-06
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: HSC20 (HSCB), N-terminal (J) domain
species: Escherichia coli [TaxId: 562]
 Score = 55.0 bits (132), Expect = 7e-11
 Identities = 13/73 (17%), Positives = 28/73 (38%), Gaps = 8/73 (10%)

Query: 7  DHYRVLGLPSGEEGAKLTEKEISKAYKWKALELHPDKRPDDPDA-----HDNFQKLKSSY 61
          D++ + GLP      +L  + +S  ++    + HPDK      A           +  ++
Sbjct: 2  DYFTLFGLP---ARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATINQAW 58

Query: 62 EILKDEKARKLFD 74
          + L+    R  + 
Sbjct: 59 QTLRHPLMRAEYL 71


>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query292
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.85
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.76
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.71
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.69
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.6
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.6
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.58
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.18
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.15
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.09
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.08
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.07
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.06
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.05
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.05
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.04
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.03
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.03
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.03
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.03
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.03
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.02
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.02
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.01
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.01
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.0
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.0
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.0
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.0
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.0
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 98.99
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.99
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 98.98
d2cpja186 Non-POU domain-containing octamer-binding protein, 98.98
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 98.98
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.98
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 98.98
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 98.98
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.95
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.95
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.94
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 98.94
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 98.93
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.92
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.92
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 98.92
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 98.91
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.89
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 98.89
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 98.89
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 98.89
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.88
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 98.88
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.88
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 98.88
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 98.88
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 98.88
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 98.88
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 98.85
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.85
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 98.84
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 98.84
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 98.83
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 98.83
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 98.82
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 98.82
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.82
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.81
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 98.8
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.8
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 98.8
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 98.79
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.79
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 98.77
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 98.75
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.73
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 98.73
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 98.71
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.7
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 98.68
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 98.67
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 98.67
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 98.66
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 98.61
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 98.59
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 98.58
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 98.56
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.49
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 98.46
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 98.34
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.27
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.25
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.18
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 98.14
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 93.24
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 92.82
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 86.24
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]
Probab=99.85  E-value=8.4e-22  Score=145.47  Aligned_cols=68  Identities=37%  Similarity=0.680  Sum_probs=64.8

Q ss_pred             CcccccccccccCCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChhHHHHHHHHHHHHHHccCchhhhhHHHHH
Q 022759            5 HVDHYRVLGLPSGEEGAKLTEKEISKAYKWKALELHPDKRPDDPDAHDNFQKLKSSYEILKDEKARKLFDDLL   77 (292)
Q Consensus         5 ~~d~Y~iLgv~~~~~~~~a~~~eIkkaYrk~al~~HPDk~~~~~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~~   77 (292)
                      ..|||+||||+++     +|..+|++|||+++++||||++++++.+...|..|++||+||+||.+|..||..+
T Consensus         2 k~dyY~vLgv~~~-----As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g   69 (75)
T d1xbla_           2 KQDYYEILGVSKT-----AEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYG   69 (75)
T ss_dssp             CCCTTTTTCCSSS-----CCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHT
T ss_pred             CCCHHHHcCCCCC-----cCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhC
Confidence            3699999999998     8999999999999999999999988889999999999999999999999999875



>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure