Citrus Sinensis ID: 022786


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290--
MFKVYPGQRTGGIEADMMAANELNAHSSSKGLCQNLVVLVGGFETKTGEQWLAFRSDGKYSAADYAKLTSEKISKNHSAGESSWNRFETEQILKRRRYFVIKLFQGAMSGLAYMHDHDRLHQSLGPSSVILNTIVEKDAAYLVPRLRDLSFSVDISFQNLEEDPGTFSEGLWRRAAAAGAFTPMEKRAFGIADDVYEAGLLLAYLAFVTFCEANVMDSLSLQRLLESTFRLDLQATREYCLADDRLLEAVKFLDLGEGAGWELLQAMLNPDFQQRPIAEAVINHRFTAGAVL
cccccccccccccHHHHHHHHHHHHHcccccccccHHHHccccccccccEEEEEECcccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccccccccccCECccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHccccccHHHHHHHHcccccccccccHHHHHcccccccccc
*FK****QRTGGIEADMMAANELNA****KGLCQNLVVLVGGFETKTGEQWLAFRSDGKYSAADYAKL***************WNRFETEQILKRRRYFVIKLFQGAMSGLAYMHDHDRLHQSLGPSSVILNTIVEKDAAYLVPRLRDLSFSVDISFQNLEEDPGTFSEGLWRRAAAAGAFTPMEKRAFGIADDVYEAGLLLAYLAFVTFCEANVMDSLSLQRLLESTFRLDLQATREYCLADDRLLEAVKFLDLGEGAGWELLQAMLNPDFQQRPIAEAVINHRFTAGAVL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFKVYPGQRTGGIEADMMAANELNAHSSSKGLCQNLVVLVGGFETKTGEQWLAFRSDGKYSAADYAKLTSEKISKNHSAGESSWNRFETEQILKRRRYFVIKLFQGAMSGLAYMHDHDRLHQSLGPSSVILNTIVEKDAAYLVPRLRDLSFSVDISFQNLEEDPGTFSEGLWRRAAAAGAFTPMEKRAFGIADDVYEAGLLLAYLAFVTFCEANVMDSLSLQRLLESTFRLDLQATREYCLADDRLLEAVKFLDLGEGAGWELLQAMLNPDFQQRPIAEAVINHRFTAGAVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MI9, chain A
Confidence level:very confident
Coverage over the Query: 17-72,87-290
View the alignment between query and template
View the model in PyMOL
Template: 3HKO, chain A
Confidence level:confident
Coverage over the Query: 17-234,245-290
View the alignment between query and template
View the model in PyMOL