Citrus Sinensis ID: 022806


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290--
MDDDALNMRNWGYYEPSFKGHLGLQLMSTMPMVDRDTKPFLPGRDPNIMIGANGAFHPRDCVVSEASIPMNYMRDSWISQRDKFLNMLPSNPTFGVLPETSGAHSLQMLQPPPNMSRDDRLAPDRVAPDRIVPKVEEPVVKTEGAPVKKRQGGGASKMPKAKKPKKPKDNNGTAVQRVKPAKKSMDVVINGIDMDISGIPIPVCSCTGAPQQCYRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEGYNFANPIDLRTHWARHGTNKFVTIR
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcEEEECccccccccECcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHcccccEEEEc
**DDALNMRNWGYYEPSFKGHLGLQLMSTMPMVDR*TKPFLPGRDPNIMIGANGAFHPRDCVVSEASIPMNYMRDSWISQRDKFLNMLPSNP********************************************************************************************MDVVINGIDMDISGIPIPVCSCTGAPQQCYRWGCGGWQSACCTTNVSMYPLPM*************MSQGAFKKVLEKLAAEGYNFANPIDLRTHWARHGTNKFVTIR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDDALNMRNWGYYEPSFKGHLGLQLMSTMPMVDRDTKPFLPGRDPNIMIGANGAFHPRDCVVSEASIPMNYMRDSWISQRDKFLNMLPSNPTFGVLPETSGAHSLQMLQPPPNMSRDDRLAPDRVAPDRIVPKVEEPVVKTEGAPVKKRQGGGASKMPKAKKPKKPKDNNGTAVQRVKPAKKSMDVVINGIDMDISGIPIPVCSCTGAPQQCYRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEGYNFANPIDLRTHWARHGTNKFVTIR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein BASIC PENTACYSTEINE1 Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. Negatively regulates the homeotic gene AGL11/STK, which controls ovule primordium identity, by a cooperative binding to purine-rich elements present in the regulatory sequence leading to DNA conformational changes.probableQ9SKD0
Barley B recombinant-like protein A Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.probableP0DH88
Barley B recombinant-like protein B Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.probableP0DH89

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted