BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 022850
         (291 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|B9EB51|MURD_MACCJ UDP-N-acetylmuramoylalanine--D-glutamate ligase OS=Macrococcus
           caseolyticus (strain JCSC5402) GN=murD PE=3 SV=1
          Length = 445

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 13/77 (16%)

Query: 216 VLQNY---------SGEEELCCVYVPTNHLYIGDIFLINTKDVIRPNLSVREGIEIVVS- 265
           +LQNY         S +E++   Y+  N +Y  D F+I+ KD++ P +   E +   ++ 
Sbjct: 228 LLQNYNIKSKVVYFSTDEKVEGAYIDQNKVYFYDEFIIDVKDIVLPGVHNLENVLASIAA 287

Query: 266 ---GGMSMPQILSTLET 279
               G+    I  TL+T
Sbjct: 288 AKLAGIDNIHICDTLKT 304


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.326    0.140    0.427 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 102,562,836
Number of Sequences: 539616
Number of extensions: 4070188
Number of successful extensions: 16436
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 16430
Number of HSP's gapped (non-prelim): 9
length of query: 291
length of database: 191,569,459
effective HSP length: 116
effective length of query: 175
effective length of database: 128,974,003
effective search space: 22570450525
effective search space used: 22570450525
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 61 (28.1 bits)