BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 022862
(291 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3A2E|A Chain A, Crystal Structure Of Ginkbilobin-2, The Novel Antifungal
Protein From Ginkgo Biloba Seeds
pdb|3A2E|B Chain B, Crystal Structure Of Ginkbilobin-2, The Novel Antifungal
Protein From Ginkgo Biloba Seeds
pdb|3A2E|C Chain C, Crystal Structure Of Ginkbilobin-2, The Novel Antifungal
Protein From Ginkgo Biloba Seeds
pdb|3A2E|D Chain D, Crystal Structure Of Ginkbilobin-2, The Novel Antifungal
Protein From Ginkgo Biloba Seeds
Length = 108
Score = 41.6 bits (96), Expect = 5e-04, Method: Compositional matrix adjust.
Identities = 17/60 (28%), Positives = 30/60 (50%)
Query: 83 GSSPQDVVYGLYQCRGDLSMPDCATCVARAVTQVGGLCYQDCGGALQLQGCYVKYDNATF 142
GS YG C+ +S DC C++ V ++ +C G +QL C+++Y+ +F
Sbjct: 49 GSGGAPTAYGRATCKQSISQSDCTACLSNLVNRIFSICNNAIGARVQLVDCFIQYEQRSF 108
Score = 33.1 bits (74), Expect = 0.18, Method: Compositional matrix adjust.
Identities = 17/53 (32%), Positives = 25/53 (47%)
Query: 186 GGARDVQGLAQCVGDLSAGECQDCLVQAIGRLKSDCGTADYGDMFLGKCYVRY 238
GGA G A C +S +C CL + R+ S C A + L C+++Y
Sbjct: 51 GGAPTAYGRATCKQSISQSDCTACLSNLVNRIFSICNNAIGARVQLVDCFIQY 103
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.138 0.426
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,377,437
Number of Sequences: 62578
Number of extensions: 290422
Number of successful extensions: 495
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 491
Number of HSP's gapped (non-prelim): 4
length of query: 291
length of database: 14,973,337
effective HSP length: 98
effective length of query: 193
effective length of database: 8,840,693
effective search space: 1706253749
effective search space used: 1706253749
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)