BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 022876
         (290 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1N1F|A Chain A, Crystal Structure Of Human Interleukin-19
          Length = 159

 Score = 31.6 bits (70), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 23/36 (63%)

Query: 59 VLIPLSVVMVLIGILRYFVSKLMRSSQVPDPKIVKE 94
          ++ PL V  V   +L ++V ++ +  Q P+PKI+++
Sbjct: 50 IIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRK 85


>pdb|1XFV|A Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3' Deoxy-Atp
 pdb|1XFV|B Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3' Deoxy-Atp
 pdb|1XFV|C Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3' Deoxy-Atp
 pdb|1XFV|D Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3' Deoxy-Atp
 pdb|1XFV|E Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3' Deoxy-Atp
 pdb|1XFV|F Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3' Deoxy-Atp
 pdb|1XFW|A Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3'5' Cyclic Amp (Camp)
 pdb|1XFW|B Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3'5' Cyclic Amp (Camp)
 pdb|1XFW|C Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3'5' Cyclic Amp (Camp)
 pdb|1XFW|D Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3'5' Cyclic Amp (Camp)
 pdb|1XFW|E Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3'5' Cyclic Amp (Camp)
 pdb|1XFW|F Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And 3'5' Cyclic Amp (Camp)
 pdb|1XFX|A Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin In The Presence Of 10 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1XFX|B Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin In The Presence Of 10 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1XFX|C Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin In The Presence Of 10 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1XFX|D Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin In The Presence Of 10 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1XFX|E Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin In The Presence Of 10 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1XFX|F Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin In The Presence Of 10 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1XFY|A Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin
 pdb|1XFY|B Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin
 pdb|1XFY|C Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin
 pdb|1XFY|D Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin
 pdb|1XFY|E Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin
 pdb|1XFY|F Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin
 pdb|1XFZ|A Chain A, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
           With Calmodulin In The Presence Of 1 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1XFZ|B Chain B, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
           With Calmodulin In The Presence Of 1 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1XFZ|C Chain C, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
           With Calmodulin In The Presence Of 1 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1XFZ|D Chain D, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
           With Calmodulin In The Presence Of 1 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1XFZ|E Chain E, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
           With Calmodulin In The Presence Of 1 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1XFZ|F Chain F, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
           With Calmodulin In The Presence Of 1 Millimolar
           Exogenously Added Calcium Chloride
 pdb|1Y0V|A Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And Pyrophosphate
 pdb|1Y0V|B Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And Pyrophosphate
 pdb|1Y0V|C Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And Pyrophosphate
 pdb|1Y0V|D Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And Pyrophosphate
 pdb|1Y0V|E Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And Pyrophosphate
 pdb|1Y0V|F Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
           With Calmodulin And Pyrophosphate
          Length = 777

 Score = 28.9 bits (63), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 49/97 (50%), Gaps = 15/97 (15%)

Query: 189 LTQRFRSMLQNGIDLSTVDVSYVSSRSWYFLNLFGLRGLFSLILGEENAT-------DDT 241
            +Q+F+  L+  ++  ++D++++      F + F L   FS     ++ T       D  
Sbjct: 187 FSQKFKEKLE--LNNKSIDINFIKENLTEFQHAFSL--AFSYYFAPDHRTVLELYAPDMF 242

Query: 242 QRMMQMSGFGFDP-SKSL---GAEKDSLDIIQHEWAL 274
           + M ++   GF+  S+SL   G EKD +D+++ E AL
Sbjct: 243 EYMNKLEKGGFEKISESLKKEGVEKDRIDVLKGEKAL 279


>pdb|1XFU|A Chain A, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
           Mutant, Ef-delta 64 In Complex With Calmodulin
 pdb|1XFU|B Chain B, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
           Mutant, Ef-delta 64 In Complex With Calmodulin
 pdb|1XFU|C Chain C, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
           Mutant, Ef-delta 64 In Complex With Calmodulin
 pdb|1XFU|D Chain D, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
           Mutant, Ef-delta 64 In Complex With Calmodulin
 pdb|1XFU|E Chain E, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
           Mutant, Ef-delta 64 In Complex With Calmodulin
 pdb|1XFU|F Chain F, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
           Mutant, Ef-delta 64 In Complex With Calmodulin
          Length = 747

 Score = 28.9 bits (63), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 49/97 (50%), Gaps = 15/97 (15%)

Query: 189 LTQRFRSMLQNGIDLSTVDVSYVSSRSWYFLNLFGLRGLFSLILGEENAT-------DDT 241
            +Q+F+  L+  ++  ++D++++      F + F L   FS     ++ T       D  
Sbjct: 157 FSQKFKEKLE--LNNKSIDINFIKENLTEFQHAFSL--AFSYYFAPDHRTVLELYAPDMF 212

Query: 242 QRMMQMSGFGFDP-SKSL---GAEKDSLDIIQHEWAL 274
           + M ++   GF+  S+SL   G EKD +D+++ E AL
Sbjct: 213 EYMNKLEKGGFEKISESLKKEGVEKDRIDVLKGEKAL 249


>pdb|2ZB4|A Chain A, Crystal Structure Of Human 15-Ketoprostaglandin Delta-13-
           Reductase In Complex With Nadp And 15-Keto-Pge2
 pdb|2ZB7|A Chain A, Crystal Structure Of Human 15-Ketoprostaglandin Delta-13-
           Reductase In Complex With Nadph And Nicotinamide
 pdb|2ZB8|A Chain A, Crystal Structure Of Human 15-Ketoprostaglandin Delta-13-
           Reductase In Complex With Nadp And Indomethacin
          Length = 357

 Score = 27.7 bits (60), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 199 NGIDLSTVDVSYVSSRSWYFLNLFGLRGLFSLILGEENA--TDDTQRMMQMSG 249
           +G  L  VD   V     YFL   G+ GL SLI  +E    T  + + M +SG
Sbjct: 116 DGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGSNKTMVVSG 168


>pdb|2W4Q|A Chain A, Crystal Structure Of Human Zinc-Binding Alcohol
           Dehydrogenase 1 (Zadh1) In Ternary Complex With Nadp And
           18beta-Glycyrrhetinic Acid
 pdb|2VNA|A Chain A, Structure Of Human Zinc-Binding Alcohol Dehydrogenase 1 (
           Zadh1)
 pdb|2W98|A Chain A, Crystal Structure Of Human Zinc-Binding Alcohol
           Dehydrogenase 1 (Zadh1) In Ternary Complex With Nadp And
           Phenylbutazone
 pdb|2W98|B Chain B, Crystal Structure Of Human Zinc-Binding Alcohol
           Dehydrogenase 1 (Zadh1) In Ternary Complex With Nadp And
           Phenylbutazone
          Length = 357

 Score = 27.7 bits (60), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 199 NGIDLSTVDVSYVSSRSWYFLNLFGLRGLFSLILGEENA--TDDTQRMMQMSG 249
           +G  L  VD   V     YFL   G+ GL SLI  +E    T  + + M +SG
Sbjct: 111 DGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGSNKTMVVSG 163


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.137    0.404 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,252,064
Number of Sequences: 62578
Number of extensions: 254737
Number of successful extensions: 609
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 607
Number of HSP's gapped (non-prelim): 6
length of query: 290
length of database: 14,973,337
effective HSP length: 98
effective length of query: 192
effective length of database: 8,840,693
effective search space: 1697413056
effective search space used: 1697413056
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)