BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 022876
(290 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1N1F|A Chain A, Crystal Structure Of Human Interleukin-19
Length = 159
Score = 31.6 bits (70), Expect = 0.54, Method: Compositional matrix adjust.
Identities = 11/36 (30%), Positives = 23/36 (63%)
Query: 59 VLIPLSVVMVLIGILRYFVSKLMRSSQVPDPKIVKE 94
++ PL V V +L ++V ++ + Q P+PKI+++
Sbjct: 50 IIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRK 85
>pdb|1XFV|A Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3' Deoxy-Atp
pdb|1XFV|B Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3' Deoxy-Atp
pdb|1XFV|C Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3' Deoxy-Atp
pdb|1XFV|D Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3' Deoxy-Atp
pdb|1XFV|E Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3' Deoxy-Atp
pdb|1XFV|F Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3' Deoxy-Atp
pdb|1XFW|A Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3'5' Cyclic Amp (Camp)
pdb|1XFW|B Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3'5' Cyclic Amp (Camp)
pdb|1XFW|C Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3'5' Cyclic Amp (Camp)
pdb|1XFW|D Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3'5' Cyclic Amp (Camp)
pdb|1XFW|E Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3'5' Cyclic Amp (Camp)
pdb|1XFW|F Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And 3'5' Cyclic Amp (Camp)
pdb|1XFX|A Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin In The Presence Of 10 Millimolar
Exogenously Added Calcium Chloride
pdb|1XFX|B Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin In The Presence Of 10 Millimolar
Exogenously Added Calcium Chloride
pdb|1XFX|C Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin In The Presence Of 10 Millimolar
Exogenously Added Calcium Chloride
pdb|1XFX|D Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin In The Presence Of 10 Millimolar
Exogenously Added Calcium Chloride
pdb|1XFX|E Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin In The Presence Of 10 Millimolar
Exogenously Added Calcium Chloride
pdb|1XFX|F Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin In The Presence Of 10 Millimolar
Exogenously Added Calcium Chloride
pdb|1XFY|A Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin
pdb|1XFY|B Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin
pdb|1XFY|C Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin
pdb|1XFY|D Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin
pdb|1XFY|E Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin
pdb|1XFY|F Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin
pdb|1XFZ|A Chain A, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
With Calmodulin In The Presence Of 1 Millimolar
Exogenously Added Calcium Chloride
pdb|1XFZ|B Chain B, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
With Calmodulin In The Presence Of 1 Millimolar
Exogenously Added Calcium Chloride
pdb|1XFZ|C Chain C, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
With Calmodulin In The Presence Of 1 Millimolar
Exogenously Added Calcium Chloride
pdb|1XFZ|D Chain D, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
With Calmodulin In The Presence Of 1 Millimolar
Exogenously Added Calcium Chloride
pdb|1XFZ|E Chain E, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
With Calmodulin In The Presence Of 1 Millimolar
Exogenously Added Calcium Chloride
pdb|1XFZ|F Chain F, Crystal Structure Of Anthrax Edema Factor (ef) In Complex
With Calmodulin In The Presence Of 1 Millimolar
Exogenously Added Calcium Chloride
pdb|1Y0V|A Chain A, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And Pyrophosphate
pdb|1Y0V|B Chain B, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And Pyrophosphate
pdb|1Y0V|C Chain C, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And Pyrophosphate
pdb|1Y0V|D Chain D, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And Pyrophosphate
pdb|1Y0V|E Chain E, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And Pyrophosphate
pdb|1Y0V|F Chain F, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex
With Calmodulin And Pyrophosphate
Length = 777
Score = 28.9 bits (63), Expect = 3.7, Method: Compositional matrix adjust.
Identities = 25/97 (25%), Positives = 49/97 (50%), Gaps = 15/97 (15%)
Query: 189 LTQRFRSMLQNGIDLSTVDVSYVSSRSWYFLNLFGLRGLFSLILGEENAT-------DDT 241
+Q+F+ L+ ++ ++D++++ F + F L FS ++ T D
Sbjct: 187 FSQKFKEKLE--LNNKSIDINFIKENLTEFQHAFSL--AFSYYFAPDHRTVLELYAPDMF 242
Query: 242 QRMMQMSGFGFDP-SKSL---GAEKDSLDIIQHEWAL 274
+ M ++ GF+ S+SL G EKD +D+++ E AL
Sbjct: 243 EYMNKLEKGGFEKISESLKKEGVEKDRIDVLKGEKAL 279
>pdb|1XFU|A Chain A, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
Mutant, Ef-delta 64 In Complex With Calmodulin
pdb|1XFU|B Chain B, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
Mutant, Ef-delta 64 In Complex With Calmodulin
pdb|1XFU|C Chain C, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
Mutant, Ef-delta 64 In Complex With Calmodulin
pdb|1XFU|D Chain D, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
Mutant, Ef-delta 64 In Complex With Calmodulin
pdb|1XFU|E Chain E, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
Mutant, Ef-delta 64 In Complex With Calmodulin
pdb|1XFU|F Chain F, Crystal Structure Of Anthrax Edema Factor (ef) Truncation
Mutant, Ef-delta 64 In Complex With Calmodulin
Length = 747
Score = 28.9 bits (63), Expect = 3.9, Method: Compositional matrix adjust.
Identities = 25/97 (25%), Positives = 49/97 (50%), Gaps = 15/97 (15%)
Query: 189 LTQRFRSMLQNGIDLSTVDVSYVSSRSWYFLNLFGLRGLFSLILGEENAT-------DDT 241
+Q+F+ L+ ++ ++D++++ F + F L FS ++ T D
Sbjct: 157 FSQKFKEKLE--LNNKSIDINFIKENLTEFQHAFSL--AFSYYFAPDHRTVLELYAPDMF 212
Query: 242 QRMMQMSGFGFDP-SKSL---GAEKDSLDIIQHEWAL 274
+ M ++ GF+ S+SL G EKD +D+++ E AL
Sbjct: 213 EYMNKLEKGGFEKISESLKKEGVEKDRIDVLKGEKAL 249
>pdb|2ZB4|A Chain A, Crystal Structure Of Human 15-Ketoprostaglandin Delta-13-
Reductase In Complex With Nadp And 15-Keto-Pge2
pdb|2ZB7|A Chain A, Crystal Structure Of Human 15-Ketoprostaglandin Delta-13-
Reductase In Complex With Nadph And Nicotinamide
pdb|2ZB8|A Chain A, Crystal Structure Of Human 15-Ketoprostaglandin Delta-13-
Reductase In Complex With Nadp And Indomethacin
Length = 357
Score = 27.7 bits (60), Expect = 7.6, Method: Compositional matrix adjust.
Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 2/53 (3%)
Query: 199 NGIDLSTVDVSYVSSRSWYFLNLFGLRGLFSLILGEENA--TDDTQRMMQMSG 249
+G L VD V YFL G+ GL SLI +E T + + M +SG
Sbjct: 116 DGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGSNKTMVVSG 168
>pdb|2W4Q|A Chain A, Crystal Structure Of Human Zinc-Binding Alcohol
Dehydrogenase 1 (Zadh1) In Ternary Complex With Nadp And
18beta-Glycyrrhetinic Acid
pdb|2VNA|A Chain A, Structure Of Human Zinc-Binding Alcohol Dehydrogenase 1 (
Zadh1)
pdb|2W98|A Chain A, Crystal Structure Of Human Zinc-Binding Alcohol
Dehydrogenase 1 (Zadh1) In Ternary Complex With Nadp And
Phenylbutazone
pdb|2W98|B Chain B, Crystal Structure Of Human Zinc-Binding Alcohol
Dehydrogenase 1 (Zadh1) In Ternary Complex With Nadp And
Phenylbutazone
Length = 357
Score = 27.7 bits (60), Expect = 8.1, Method: Compositional matrix adjust.
Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 2/53 (3%)
Query: 199 NGIDLSTVDVSYVSSRSWYFLNLFGLRGLFSLILGEENA--TDDTQRMMQMSG 249
+G L VD V YFL G+ GL SLI +E T + + M +SG
Sbjct: 111 DGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGSNKTMVVSG 163
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.324 0.137 0.404
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,252,064
Number of Sequences: 62578
Number of extensions: 254737
Number of successful extensions: 609
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 607
Number of HSP's gapped (non-prelim): 6
length of query: 290
length of database: 14,973,337
effective HSP length: 98
effective length of query: 192
effective length of database: 8,840,693
effective search space: 1697413056
effective search space used: 1697413056
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)