Citrus Sinensis ID: 022924

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290

MYGQSQSMNISSQMSGGGAAADEDDVSVAADDHHLSYDPHSALENGIVVVEDVAHDSGYATGGNELSNSSQLTLSFRGQVYVFDSVTPDKVQAVLLLLGGCELSSSPQGMEVIPHSQRGIADYPAKCTQPQRAASLDRFRQKRKERCFDKKVRYSVRQEVALRMQRNKGQFTSAKKCEGGALGWSNAQDPGQDDSPSETSCTHCGISSKSTPMMRRGPSGPRSLCNACGLFWANKGALRDLGKKMEDQPLTPAEQGEGEVNDSDCGTAAHTDNELVSFSNDDDSALISEH

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccEEEEccccccHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccc

****************************************SALENGIVVVEDVAHDSG************QLTLSFRGQVYVFDSVTPDKVQAVLLLLGGCEL*******************************************CFDKKVRYSVR*******************CEGGALGWSNA**********ETSCTHCGISSKSTPMMRRGPSGPRSLCNACGLFWANKGA*****************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
GATA transcription factor 25	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	probable	Q9LRH6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GAT, chain A
Confidence level:very confident
Coverage over the Query: 197-253
View the alignment between query and template
View the model in PyMOL

Template: 3OGK, chain Q
Confidence level:probable
Coverage over the Query: 132-140
View the alignment between query and template
View the model in PyMOL