Citrus Sinensis ID: 022928
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 290 | ||||||
| 225441425 | 297 | PREDICTED: zinc finger CCCH domain-conta | 0.996 | 0.973 | 0.748 | 1e-121 | |
| 255585533 | 295 | conserved hypothetical protein [Ricinus | 0.986 | 0.969 | 0.755 | 1e-119 | |
| 255585535 | 295 | conserved hypothetical protein [Ricinus | 0.986 | 0.969 | 0.744 | 1e-115 | |
| 449457299 | 305 | PREDICTED: zinc finger CCCH domain-conta | 0.989 | 0.940 | 0.704 | 1e-114 | |
| 449437587 | 296 | PREDICTED: zinc finger CCCH domain-conta | 0.989 | 0.969 | 0.722 | 1e-113 | |
| 363807948 | 295 | uncharacterized protein LOC100803981 [Gl | 0.989 | 0.972 | 0.724 | 1e-112 | |
| 356504857 | 295 | PREDICTED: zinc finger CCCH domain-conta | 0.986 | 0.969 | 0.712 | 1e-109 | |
| 356504859 | 295 | PREDICTED: zinc finger CCCH domain-conta | 0.986 | 0.969 | 0.712 | 1e-109 | |
| 255634442 | 295 | unknown [Glycine max] | 0.986 | 0.969 | 0.709 | 1e-109 | |
| 224139806 | 285 | predicted protein [Populus trichocarpa] | 0.965 | 0.982 | 0.693 | 1e-106 |
| >gi|225441425|ref|XP_002279071.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 442 bits (1136), Expect = e-121, Method: Compositional matrix adjust.
Identities = 223/298 (74%), Positives = 247/298 (82%), Gaps = 9/298 (3%)
Query: 1 MDTRKRTKPETGINANGVFKKSKHESES---GVGSKSKPCTKFFSTAGCPFGESCHFLHY 57
MDTRKR +P +NANG FKKSK E ES G+GSKSKPCTKFFST+GCPFGESCHFLHY
Sbjct: 1 MDTRKRGRPGGALNANGGFKKSKQEVESLSTGIGSKSKPCTKFFSTSGCPFGESCHFLHY 60
Query: 58 FPGGYNAVAQMMNLPQAVPAPSRNMA-VPPPASNGPTV--VKSRMCNRLNSAEGCKFGDK 114
PGGYNAVAQM N +P SRNMA PPP NG ++ VKS+MCN+ N+AEGCKFGDK
Sbjct: 61 VPGGYNAVAQMTNQAPILPPASRNMAGPPPPVPNGSSMPAVKSKMCNKFNTAEGCKFGDK 120
Query: 115 CHFAHGEWELGKPIAISHDDPRAFGAVPGRMGGRYEPPPAPGPAASFGASATAKISVDAS 174
CHFAHGEWELGKP+A HDDPRA G++PGR+ GR EP P GPAASFGASATAKISVDAS
Sbjct: 121 CHFAHGEWELGKPLAPYHDDPRAMGSIPGRLAGRIEPSPT-GPAASFGASATAKISVDAS 179
Query: 175 LAGAIIGKGGVNSKQICRQTGAKLSIRDHEADPNLRNIELEGSFEQIKQASAMVRELIVR 234
LAGAIIGKGGVNSKQICRQTGAKLSIR+H++DPNLRNIELEG+FEQIK+ASAMVRELIV
Sbjct: 180 LAGAIIGKGGVNSKQICRQTGAKLSIREHDSDPNLRNIELEGTFEQIKEASAMVRELIVN 239
Query: 235 IG--PAHAKNPATAGSAAHPLSSNFKTKLCGNFAKGSCTFGDRCHFAHGAAELRKTAI 290
I P HA+ A G P +SN+KTKLC NF KGSCTFG+RCHFAHGA ELRK+AI
Sbjct: 240 ISAMPGHARTTAMPGGGQAPPASNYKTKLCDNFTKGSCTFGERCHFAHGAGELRKSAI 297
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255585533|ref|XP_002533457.1| conserved hypothetical protein [Ricinus communis] gi|223526690|gb|EEF28926.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255585535|ref|XP_002533458.1| conserved hypothetical protein [Ricinus communis] gi|223526691|gb|EEF28927.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449457299|ref|XP_004146386.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Cucumis sativus] gi|449480828|ref|XP_004156007.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449437587|ref|XP_004136573.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|363807948|ref|NP_001242454.1| uncharacterized protein LOC100803981 [Glycine max] gi|255636900|gb|ACU18783.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356504857|ref|XP_003521211.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356504859|ref|XP_003521212.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255634442|gb|ACU17586.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224139806|ref|XP_002323285.1| predicted protein [Populus trichocarpa] gi|222867915|gb|EEF05046.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 290 | ||||||
| TAIR|locus:2170169 | 240 | AT5G06770 [Arabidopsis thalian | 0.651 | 0.787 | 0.509 | 2.3e-46 | |
| TAIR|locus:2099292 | 248 | AT3G12130 [Arabidopsis thalian | 0.658 | 0.770 | 0.518 | 6.2e-46 | |
| TAIR|locus:2028306 | 384 | AT1G32360 [Arabidopsis thalian | 0.144 | 0.109 | 0.5 | 3.8e-10 | |
| UNIPROTKB|P26651 | 326 | ZFP36 "Tristetraprolin" [Homo | 0.193 | 0.171 | 0.413 | 0.00013 | |
| TAIR|locus:2090669 | 386 | AT3G19360 [Arabidopsis thalian | 0.151 | 0.113 | 0.458 | 9.1e-07 | |
| RGD|620722 | 320 | Zfp36 "zinc finger protein 36" | 0.193 | 0.175 | 0.413 | 0.00036 | |
| UNIPROTKB|P47973 | 320 | Zfp36 "Tristetraprolin" [Rattu | 0.193 | 0.175 | 0.413 | 0.00036 | |
| WB|WBGene00009532 | 460 | ccch-1 [Caenorhabditis elegans | 0.334 | 0.210 | 0.291 | 2.3e-07 | |
| UNIPROTKB|Q6S9E0 | 325 | ZFP36 "Tristetraprolin" [Ovis | 0.175 | 0.156 | 0.415 | 0.00082 | |
| MGI|MGI:99180 | 319 | Zfp36 "zinc finger protein 36" | 0.193 | 0.175 | 0.413 | 0.00036 |
| TAIR|locus:2170169 AT5G06770 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 486 (176.1 bits), Expect = 2.3e-46, P = 2.3e-46
Identities = 106/208 (50%), Positives = 131/208 (62%)
Query: 96 KSRMCNRLNSAEGCKFGDKCHFAH---GEWE-------LGKPIAISHDDPRAFGAVPGRM 145
KS+ C + S GC FGD CHF H G + L P++ + + G GR
Sbjct: 38 KSKPCTKFFSTSGCPFGDNCHFLHYVPGGYNAAAQMTNLRPPVSQVSRNMQGSGGPGGRF 97
Query: 146 GGRYEXXXXXXXXXXXXXXXTAKISVDASLAGAIIGKGGVNSKQICRQTGAKLSIRDHEA 205
GR + T+KISVDASLAGAIIGKGG++SKQICR+TGAKLSI+DHE
Sbjct: 98 SGRGDPGSGPVSIFGAS---TSKISVDASLAGAIIGKGGIHSKQICRETGAKLSIKDHER 154
Query: 206 DPNLRNIELEGSFEQIKQASAMVRELIVRIGPAHAKNPATAGSAA---HPLSSNFKTKLC 262
DPNL+ IELEG+FEQI AS MVRELI R+G K P G HP SN+KTK+C
Sbjct: 155 DPNLKIIELEGTFEQINVASGMVRELIGRLGSV--KKPQGIGGPEGKPHP-GSNYKTKIC 211
Query: 263 GNFAKGSCTFGDRCHFAHGAAELRKTAI 290
++KG+CT+GDRCHFAHG +ELR++ I
Sbjct: 212 DRYSKGNCTYGDRCHFAHGESELRRSGI 239
|
|
| TAIR|locus:2099292 AT3G12130 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2028306 AT1G32360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P26651 ZFP36 "Tristetraprolin" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2090669 AT3G19360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| RGD|620722 Zfp36 "zinc finger protein 36" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P47973 Zfp36 "Tristetraprolin" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00009532 ccch-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6S9E0 ZFP36 "Tristetraprolin" [Ovis aries (taxid:9940)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:99180 Zfp36 "zinc finger protein 36" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 290 | |||
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 8e-15 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 2e-12 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 2e-12 | |
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 4e-09 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 3e-08 | |
| smart00356 | 27 | smart00356, ZnF_C3H1, zinc finger | 9e-07 | |
| pfam00642 | 27 | pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H t | 2e-06 | |
| cd02394 | 62 | cd02394, vigilin_like_KH, K homology RNA-binding d | 8e-06 | |
| cd02393 | 61 | cd02393, PNPase_KH, Polynucleotide phosphorylase ( | 3e-04 | |
| PRK13764 | 602 | PRK13764, PRK13764, ATPase; Provisional | 3e-04 | |
| PRK11824 | 693 | PRK11824, PRK11824, polynucleotide phosphorylase/p | 0.001 | |
| TIGR03591 | 684 | TIGR03591, polynuc_phos, polyribonucleotide nucleo | 0.002 |
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
Score = 67.2 bits (165), Expect = 8e-15
Identities = 23/63 (36%), Positives = 38/63 (60%)
Query: 166 TAKISVDASLAGAIIGKGGVNSKQICRQTGAKLSIRDHEADPNLRNIELEGSFEQIKQAS 225
T ++ V +SL G IIGKGG K+I +TGAK+ I D + R + + G+ E +++A
Sbjct: 1 TERVLVPSSLVGRIIGKGGSTIKEIREETGAKIKIPDSGSGSEERIVTITGTPEAVEKAK 60
Query: 226 AMV 228
++
Sbjct: 61 ELI 63
|
KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. There are two different KH domains that belong to different protein folds, but they share a single KH motif. The KH motif is folded into a beta alpha alpha beta unit. In addition to the core, type II KH domains (e.g. ribosomal protein S3) include N-terminal extension and type I KH domains (e.g. hnRNP K) contain C-terminal extension. Length = 64 |
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|214632 smart00356, ZnF_C3H1, zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|144294 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H type (and similar) | Back alignment and domain information |
|---|
| >gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >gnl|CDD|239086 cd02393, PNPase_KH, Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >gnl|CDD|184311 PRK13764, PRK13764, ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 290 | |||
| KOG2191 | 402 | consensus RNA-binding protein NOVA1/PASILLA and re | 99.74 | |
| KOG1677 | 332 | consensus CCCH-type Zn-finger protein [General fun | 99.6 | |
| KOG1677 | 332 | consensus CCCH-type Zn-finger protein [General fun | 99.43 | |
| cd02396 | 65 | PCBP_like_KH K homology RNA-binding domain, PCBP_l | 99.29 | |
| COG5063 | 351 | CTH1 CCCH-type Zn-finger protein [General function | 99.19 | |
| COG5063 | 351 | CTH1 CCCH-type Zn-finger protein [General function | 99.13 | |
| KOG1676 | 600 | consensus K-homology type RNA binding proteins [RN | 99.1 | |
| KOG2192 | 390 | consensus PolyC-binding hnRNP-K protein HRB57A/hnR | 99.08 | |
| cd02394 | 62 | vigilin_like_KH K homology RNA-binding domain_vigi | 99.02 | |
| cd00105 | 64 | KH-I K homology RNA-binding domain, type I. KH bin | 98.98 | |
| PF00013 | 60 | KH_1: KH domain syndrome, contains KH motifs.; Int | 98.97 | |
| cd02393 | 61 | PNPase_KH Polynucleotide phosphorylase (PNPase) K | 98.94 | |
| KOG1676 | 600 | consensus K-homology type RNA binding proteins [RN | 98.92 | |
| PF00642 | 27 | zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si | 98.8 | |
| KOG2190 | 485 | consensus PolyC-binding proteins alphaCP-1 and rel | 98.72 | |
| KOG1040 | 325 | consensus Polyadenylation factor I complex, subuni | 98.66 | |
| PF00642 | 27 | zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si | 98.64 | |
| KOG2191 | 402 | consensus RNA-binding protein NOVA1/PASILLA and re | 98.62 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 98.6 | |
| KOG1595 | 528 | consensus CCCH-type Zn-finger protein [General fun | 98.57 | |
| PF13014 | 43 | KH_3: KH domain | 98.55 | |
| smart00322 | 69 | KH K homology RNA-binding domain. | 98.51 | |
| KOG1595 | 528 | consensus CCCH-type Zn-finger protein [General fun | 98.37 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 98.35 | |
| smart00356 | 27 | ZnF_C3H1 zinc finger. | 98.27 | |
| smart00356 | 27 | ZnF_C3H1 zinc finger. | 98.22 | |
| KOG2333 | 614 | consensus Uncharacterized conserved protein [Gener | 98.11 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 98.04 | |
| cd02395 | 120 | SF1_like-KH Splicing factor 1 (SF1) K homology RNA | 98.02 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 97.96 | |
| KOG1492 | 377 | consensus C3H1-type Zn-finger protein [General fun | 97.91 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 97.76 | |
| KOG2190 | 485 | consensus PolyC-binding proteins alphaCP-1 and rel | 97.74 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 97.57 | |
| KOG1040 | 325 | consensus Polyadenylation factor I complex, subuni | 97.45 | |
| KOG2192 | 390 | consensus PolyC-binding hnRNP-K protein HRB57A/hnR | 97.44 | |
| COG5084 | 285 | YTH1 Cleavage and polyadenylation specificity fact | 97.42 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 97.2 | |
| KOG1763 | 343 | consensus Uncharacterized conserved protein, conta | 97.18 | |
| COG5252 | 299 | Uncharacterized conserved protein, contains CCCH-t | 97.06 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 96.96 | |
| KOG2494 | 331 | consensus C3H1-type Zn-finger protein [Transcripti | 96.9 | |
| PF14608 | 19 | zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type | 96.72 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 96.64 | |
| KOG0119 | 554 | consensus Splicing factor 1/branch point binding p | 96.55 | |
| KOG4791 | 667 | consensus Uncharacterized conserved protein [Funct | 96.52 | |
| cd02134 | 61 | NusA_KH NusA_K homology RNA-binding domain (KH). N | 96.22 | |
| KOG2185 | 486 | consensus Predicted RNA-processing protein, contai | 96.14 | |
| KOG2185 | 486 | consensus Predicted RNA-processing protein, contai | 96.11 | |
| PF14608 | 19 | zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type | 96.07 | |
| KOG2494 | 331 | consensus C3H1-type Zn-finger protein [Transcripti | 96.01 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 95.93 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 95.74 | |
| KOG2113 | 394 | consensus Predicted RNA binding protein, contains | 95.37 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 95.29 | |
| KOG2333 | 614 | consensus Uncharacterized conserved protein [Gener | 95.18 | |
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 94.73 | |
| KOG2279 | 608 | consensus Kinase anchor protein AKAP149, contains | 94.48 | |
| KOG1492 | 377 | consensus C3H1-type Zn-finger protein [General fun | 94.44 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 94.06 | |
| KOG2279 | 608 | consensus Kinase anchor protein AKAP149, contains | 93.62 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 93.22 | |
| KOG1763 | 343 | consensus Uncharacterized conserved protein, conta | 93.08 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 92.95 | |
| KOG2202 | 260 | consensus U2 snRNP splicing factor, small subunit, | 92.45 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.32 | |
| COG5176 | 269 | MSL5 Splicing factor (branch point binding protein | 92.25 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 92.05 | |
| COG5084 | 285 | YTH1 Cleavage and polyadenylation specificity fact | 91.12 | |
| COG5252 | 299 | Uncharacterized conserved protein, contains CCCH-t | 91.05 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.62 | |
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 89.32 | |
| KOG2814 | 345 | consensus Transcription coactivator complex, P50 c | 89.08 | |
| KOG1588 | 259 | consensus RNA-binding protein Sam68 and related KH | 88.34 | |
| PRK00468 | 75 | hypothetical protein; Provisional | 87.7 | |
| COG1837 | 76 | Predicted RNA-binding protein (contains KH domain) | 87.5 | |
| PRK01064 | 78 | hypothetical protein; Provisional | 87.39 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 87.38 | |
| PRK02821 | 77 | hypothetical protein; Provisional | 87.37 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 86.96 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 86.73 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 86.21 | |
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 85.8 | |
| PF10650 | 23 | zf-C3H1: Putative zinc-finger domain; InterPro: IP | 84.76 | |
| PF13184 | 69 | KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW | 83.99 | |
| TIGR01952 | 141 | nusA_arch NusA family KH domain protein, archaeal. | 82.74 | |
| KOG0153 | 377 | consensus Predicted RNA-binding protein (RRM super | 82.04 | |
| cd02409 | 68 | KH-II KH-II (K homology RNA-binding domain, type I | 81.7 | |
| KOG3273 | 252 | consensus Predicted RNA-binding protein Pno1p inte | 81.51 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 81.4 | |
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 81.13 |
| >KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
Probab=99.74 E-value=2.1e-18 Score=154.11 Aligned_cols=164 Identities=21% Similarity=0.194 Sum_probs=127.9
Q ss_pred eEecccCCCchhhhhhccCCCCCCCCCCCCCC---CCCCCCCCCcccccccccccccccCCCCCcccccccccccCCCcc
Q 022928 53 HFLHYFPGGYNAVAQMMNLPQAVPAPSRNMAV---PPPASNGPTVVKSRMCNRLNSAEGCKFGDKCHFAHGEWELGKPIA 129 (290)
Q Consensus 53 ~F~H~~~~~~~~~~~~~~~g~~~~~~~~~~~~---~s~~~~~~~~~ktr~C~~~~~~g~C~~G~~C~f~H~~~el~~~~~ 129 (290)
.|+..|+|+|+++++|+++|++|.++|+++++ +|.+.+++|++.+|+|.+.++..... ..+-...+
T Consensus 39 y~ikvLips~AaGsIIGKGG~ti~~lqk~tgariklSks~dfyPGTTeRvcli~Gt~eai~---av~efI~d-------- 107 (402)
T KOG2191|consen 39 YFLKVLIPSYAAGSIIGKGGQTIVQLQKETGARIKLSKSKDFYPGTTERVCLIQGTVEALN---AVHEFIAD-------- 107 (402)
T ss_pred eEEEEEeecccccceeccchHHHHHHHhccCcEEEeccccccCCCccceEEEEeccHHHHH---HHHHHHHH--------
Confidence 88999999999999999999999999999998 78999999999999999988876444 11211212
Q ss_pred cCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcCCCCceEEEEecccccceeeCCCCCchhhHHHhhCCceeecc-CCC--C
Q 022928 130 ISHDDPRAFGAVPGRMGGRYEPPPAPGPAASFGASATAKISVDASLAGAIIGKGGVNSKQICRQTGAKLSIRD-HEA--D 206 (290)
Q Consensus 130 ~~~~~~~~~~p~~~~~~~~~~~~~~p~~~~s~~~~~t~~i~VP~~~vg~iIGkgG~~Ik~i~~~sga~i~v~~-~~~--~ 206 (290)
+++..+..........++.. -....++++.||++.+|+||||+|.+||.|+++++++|+|++ .+. .
T Consensus 108 ----Kire~p~~~~k~v~~~~pqt-------~~r~kqikivvPNstag~iigkggAtiK~~~Eqsga~iqisPqkpt~~s 176 (402)
T KOG2191|consen 108 ----KIREKPQAVAKPVDILQPQT-------PDRIKQIKIVVPNSTAGMIIGKGGATIKAIQEQSGAWIQISPQKPTGIS 176 (402)
T ss_pred ----HHHHhHHhhcCCccccCCCC-------ccccceeEEeccCCcccceecCCcchHHHHHHhhCcceEecccCCCCcc
Confidence 12222222222222222211 123577999999999999999999999999999999999984 333 3
Q ss_pred CCcceeEEcCCHHHHHHHHHHHHHHHHhcCCC
Q 022928 207 PNLRNIELEGSFEQIKQASAMVRELIVRIGPA 238 (290)
Q Consensus 207 ~~~r~v~i~G~~~~i~~A~~~I~~~i~~~~~~ 238 (290)
..+|+++++|++++..+|..+|.++|.|++..
T Consensus 177 Lqervvt~sge~e~~~~A~~~IL~Ki~eDpqs 208 (402)
T KOG2191|consen 177 LQERVVTVSGEPEQNMKAVSLILQKIQEDPQS 208 (402)
T ss_pred ceeEEEEecCCHHHHHHHHHHHHHHhhcCCcc
Confidence 34899999999999999999999999988765
|
|
| >KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >cd00105 KH-I K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >PF00013 KH_1: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1040 consensus Polyadenylation factor I complex, subunit, Yth1 (CPSF subunit) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1595 consensus CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13014 KH_3: KH domain | Back alignment and domain information |
|---|
| >smart00322 KH K homology RNA-binding domain | Back alignment and domain information |
|---|
| >KOG1595 consensus CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >smart00356 ZnF_C3H1 zinc finger | Back alignment and domain information |
|---|
| >smart00356 ZnF_C3H1 zinc finger | Back alignment and domain information |
|---|
| >KOG2333 consensus Uncharacterized conserved protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >KOG1492 consensus C3H1-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >KOG1040 consensus Polyadenylation factor I complex, subunit, Yth1 (CPSF subunit) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >KOG1763 consensus Uncharacterized conserved protein, contains CCCH-type Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2494 consensus C3H1-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4791 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type | Back alignment and domain information |
|---|
| >KOG2494 consensus C3H1-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2333 consensus Uncharacterized conserved protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1492 consensus C3H1-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >KOG1763 consensus Uncharacterized conserved protein, contains CCCH-type Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] | Back alignment and domain information |
|---|
| >KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK00468 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01064 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK02821 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >PF10650 zf-C3H1: Putative zinc-finger domain; InterPro: IPR019607 This domain is conserved in fungi and might be a zinc-finger domain as it contains three conserved Cs and an H in the C-x8-C-x5-C-x3-H conformation typical of a zinc-finger | Back alignment and domain information |
|---|
| >PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A | Back alignment and domain information |
|---|
| >TIGR01952 nusA_arch NusA family KH domain protein, archaeal | Back alignment and domain information |
|---|
| >KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >cd02409 KH-II KH-II (K homology RNA-binding domain, type II) | Back alignment and domain information |
|---|
| >KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 290 | ||||
| 1j4w_A | 174 | Complex Of The Kh3 And Kh4 Domains Of Fbp With A Si | 2e-04 | ||
| 1zzi_A | 82 | Crystal Structure Analysis Of The Third Kh Domain O | 3e-04 | ||
| 1j5k_A | 89 | Complex Of The Kh3 Domain Of Hnrnp K With A Single_ | 3e-04 | ||
| 2hh2_A | 107 | Solution Structure Of The Fourth Kh Domain Of Ksrp | 6e-04 |
| >pdb|1J4W|A Chain A, Complex Of The Kh3 And Kh4 Domains Of Fbp With A Single_stranded 29mer Dna Oligonucleotide From The Fuse Element Of The C-Myc Oncogene Length = 174 | Back alignment and structure |
|
| >pdb|1ZZI|A Chain A, Crystal Structure Analysis Of The Third Kh Domain Of Hnrnp K In Complex With Ssdna Length = 82 | Back alignment and structure |
| >pdb|1J5K|A Chain A, Complex Of The Kh3 Domain Of Hnrnp K With A Single_stranded 10mer Dna Oligonucleotide Length = 89 | Back alignment and structure |
| >pdb|2HH2|A Chain A, Solution Structure Of The Fourth Kh Domain Of Ksrp Length = 107 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 290 | |||
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 6e-23 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 2e-21 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 2e-21 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 4e-20 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 2e-19 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 2e-17 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 3e-17 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 6e-17 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 1e-16 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 4e-15 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 8e-15 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 5e-13 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 1e-14 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 7e-12 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 1e-14 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 2e-13 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 4e-12 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 2e-13 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 7e-12 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 3e-13 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 9e-13 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 1e-12 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 1e-12 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 1e-07 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 6e-06 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 9e-06 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 3e-11 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 5e-11 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 2e-10 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 4e-09 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 6e-09 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-08 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-07 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 5e-07 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 5e-05 | |
| 2d9m_A | 69 | Zinc finger CCCH-type domain containing protein 7A | 9e-07 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 9e-06 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 1e-05 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 3e-05 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 3e-04 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-04 | |
| 2cqe_A | 98 | KIAA1064 protein; CCCH zinc-finger, structural gen | 3e-04 | |
| 2d9n_A | 77 | Cleavage and polyadenylation specificity factor, 3 | 5e-04 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 5e-04 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 7e-04 |
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
Score = 88.9 bits (221), Expect = 6e-23
Identities = 23/74 (31%), Positives = 41/74 (55%)
Query: 159 ASFGASATAKISVDASLAGAIIGKGGVNSKQICRQTGAKLSIRDHEADPNLRNIELEGSF 218
+ G T ++++ LAG+IIGKGG KQI ++GA + I + R I + G+
Sbjct: 1 GAMGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQ 60
Query: 219 EQIKQASAMVRELI 232
+QI+ A +++ +
Sbjct: 61 DQIQNAQYLLQNSV 74
|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
| >2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 102 | Back alignment and structure |
|---|
| >2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Length = 98 | Back alignment and structure |
|---|
| >2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 131 | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Length = 376 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 290 | |||
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 99.66 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 99.55 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 99.45 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 99.44 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 99.42 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 99.41 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 99.4 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 99.36 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 99.35 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 99.35 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 99.34 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 99.34 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 99.34 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 99.3 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 99.29 | |
| 2d9n_A | 77 | Cleavage and polyadenylation specificity factor, 3 | 99.26 | |
| 2cqe_A | 98 | KIAA1064 protein; CCCH zinc-finger, structural gen | 99.21 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 99.2 | |
| 2rhk_C | 72 | Cleavage and polyadenylation specificity factor su | 99.14 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 99.14 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 99.07 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 99.05 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.04 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 99.03 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 98.99 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 98.98 | |
| 2d9m_A | 69 | Zinc finger CCCH-type domain containing protein 7A | 98.98 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 98.97 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 98.96 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 98.95 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 98.94 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 98.94 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 98.92 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 98.91 | |
| 2cqe_A | 98 | KIAA1064 protein; CCCH zinc-finger, structural gen | 98.84 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 98.81 | |
| 2d9n_A | 77 | Cleavage and polyadenylation specificity factor, 3 | 98.76 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 98.75 | |
| 2d9m_A | 69 | Zinc finger CCCH-type domain containing protein 7A | 98.69 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 98.68 | |
| 3d2q_A | 70 | Muscleblind-like protein 1; tandem zinc finger dom | 98.65 | |
| 2rhk_C | 72 | Cleavage and polyadenylation specificity factor su | 98.58 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 98.54 | |
| 2e5s_A | 98 | Otthump00000018578; ZF-CCCHX2 domain, muscleblind- | 98.52 | |
| 3d2q_A | 70 | Muscleblind-like protein 1; tandem zinc finger dom | 98.51 | |
| 2cpq_A | 91 | FragIle X mental retardation syndrome related prot | 98.47 | |
| 2e5s_A | 98 | Otthump00000018578; ZF-CCCHX2 domain, muscleblind- | 98.33 | |
| 2yqr_A | 119 | KIAA0907 protein; structure genomics, KH domain, s | 98.3 | |
| 3d2n_A | 83 | Muscleblind-like protein 1; tandem zinc finger dom | 98.27 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 98.25 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 98.18 | |
| 2rpp_A | 89 | Muscleblind-like protein 2; zinc finger domain, C3 | 97.86 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 97.81 | |
| 3d2n_A | 83 | Muscleblind-like protein 1; tandem zinc finger dom | 97.78 | |
| 3v69_A | 140 | Protein filia; RNA-binding, embryogenesis, KH doma | 97.76 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 97.75 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 97.72 | |
| 2bl5_A | 140 | MGC83862 protein, quaking protein; STAR proteins, | 97.67 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 97.66 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 97.44 | |
| 2rpp_A | 89 | Muscleblind-like protein 2; zinc finger domain, C3 | 97.32 | |
| 3u9g_A | 229 | Zinc finger CCCH-type antiviral protein 1; zinc fi | 97.27 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 97.23 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 97.11 | |
| 2fc6_A | 50 | Nuclear, target of EGR1, member 1; structure genom | 96.54 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 96.51 | |
| 2fc6_A | 50 | Nuclear, target of EGR1, member 1; structure genom | 94.94 | |
| 3u9g_A | 229 | Zinc finger CCCH-type antiviral protein 1; zinc fi | 94.79 | |
| 3u1l_A | 240 | PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; | 93.68 | |
| 3u1l_A | 240 | PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; | 92.15 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 91.39 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 90.53 | |
| 3v33_A | 223 | Ribonuclease ZC3H12A; rossmann-like sandwich fold, | 82.86 | |
| 3v33_A | 223 | Ribonuclease ZC3H12A; rossmann-like sandwich fold, | 82.75 | |
| 2lhn_A | 80 | Nuclear polyadenylated RNA-binding protein NAB2; n | 82.39 |
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A | Back alignment and structure |
|---|
Probab=99.66 E-value=1.8e-17 Score=120.89 Aligned_cols=70 Identities=29% Similarity=0.677 Sum_probs=29.0
Q ss_pred CCccccccccccccCCCCCCCCCceEecccCCCchhhhhhccCCCCCCCCCCCCCCCCCCCCCCCccccccccccccccc
Q 022928 29 GVGSKSKPCTKFFSTAGCPFGESCHFLHYFPGGYNAVAQMMNLPQAVPAPSRNMAVPPPASNGPTVVKSRMCNRLNSAEG 108 (290)
Q Consensus 29 ~~~~Kt~lC~~~~~~g~C~~G~~C~F~H~~~~~~~~~~~~~~~g~~~~~~~~~~~~~s~~~~~~~~~ktr~C~~~~~~g~ 108 (290)
+..|||+||++|+.+|.|+||++|+|+|++.+ +... ...+.+++++|..|...|.
T Consensus 7 ~~~~kt~~C~~f~~~G~C~~G~~C~f~H~~~e----------~~~~---------------~~~~~~k~~~C~~f~~~G~ 61 (77)
T 1m9o_A 7 SSRYKTELCRTYSESGRCRYGAKCQFAHGLGE----------LRQA---------------NRHPKYKTELCHKFKLQGR 61 (77)
T ss_dssp SSCCCSCCCSGGGGTSCCTTTTTCSSCSSSCC----------GGGT---------------C------------------
T ss_pred CCCccchhCHHhhhCCCcCCCCCccCCCCChh----------hccc---------------cccccccCCcccchhhCcC
Confidence 67899999999988899999999999998621 1100 1236788999999999999
Q ss_pred CCCCCcccccccccc
Q 022928 109 CKFGDKCHFAHGEWE 123 (290)
Q Consensus 109 C~~G~~C~f~H~~~e 123 (290)
|+||.+|+|+|...|
T Consensus 62 C~~G~~C~f~H~~~e 76 (77)
T 1m9o_A 62 CPYGSRCHFIHNPTE 76 (77)
T ss_dssp ---------------
T ss_pred CCCcCcCCCCCCCCC
Confidence 999999999997644
|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A | Back alignment and structure |
|---|
| >2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A | Back alignment and structure |
|---|
| >2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u9g_A Zinc finger CCCH-type antiviral protein 1; zinc finger protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 | Back alignment and structure |
|---|
| >3u9g_A Zinc finger CCCH-type antiviral protein 1; zinc finger protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A | Back alignment and structure |
|---|
| >3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >3v33_A Ribonuclease ZC3H12A; rossmann-like sandwich fold, RNAse, cytoplastic, hydrolase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3v33_A Ribonuclease ZC3H12A; rossmann-like sandwich fold, RNAse, cytoplastic, hydrolase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 290 | ||||
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 1e-17 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 6e-16 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 8e-16 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 2e-15 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 2e-15 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 4e-15 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 4e-15 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 8e-15 | |
| d2ctma1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 3e-13 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 3e-13 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 3e-13 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 4e-13 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 1e-12 | |
| d1m9oa_ | 40 | g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 | 5e-12 | |
| d1m9oa_ | 40 | g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 | 2e-08 | |
| d1m9oa_ | 40 | g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 | 2e-04 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 8e-12 | |
| d1rgoa1 | 36 | g.66.1.1 (A:151-186) Butyrate response factor 2 (T | 9e-12 | |
| d1rgoa1 | 36 | g.66.1.1 (A:151-186) Butyrate response factor 2 (T | 5e-08 | |
| d1rgoa1 | 36 | g.66.1.1 (A:151-186) Butyrate response factor 2 (T | 1e-04 | |
| d2ctja1 | 82 | d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T | 5e-11 | |
| d1tuaa1 | 84 | d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae | 3e-09 | |
| d1rgoa2 | 34 | g.66.1.1 (A:187-220) Butyrate response factor 2 (T | 5e-09 | |
| d1rgoa2 | 34 | g.66.1.1 (A:187-220) Butyrate response factor 2 (T | 2e-07 | |
| d1rgoa2 | 34 | g.66.1.1 (A:187-220) Butyrate response factor 2 (T | 4e-05 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 4e-08 | |
| d1tuaa2 | 104 | d.51.1.1 (A:85-188) Hypothetical protein APE0754 { | 2e-07 | |
| d1e3ha4 | 54 | d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ | 5e-06 | |
| d2cpqa1 | 78 | d.51.1.1 (A:212-289) Fragile X mental retardation | 1e-05 | |
| d2ctfa1 | 90 | d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [T | 5e-05 | |
| d2je6i3 | 69 | d.51.1.1 (I:153-221) Exosome complex RNA-binding p | 2e-04 | |
| d2z0sa2 | 87 | d.51.1.1 (A:148-234) Exosome complex RNA-binding p | 3e-04 | |
| d2bl5a1 | 134 | d.51.1.1 (A:1-134) Quaking protein A (Xqua) {Afric | 0.003 | |
| d1k1ga_ | 122 | d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo s | 0.004 |
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Far upstream binding element, FBP species: Mouse (Mus musculus) [TaxId: 10090]
Score = 73.7 bits (181), Expect = 1e-17
Identities = 17/70 (24%), Positives = 35/70 (50%)
Query: 163 ASATAKISVDASLAGAIIGKGGVNSKQICRQTGAKLSIRDHEADPNLRNIELEGSFEQIK 222
+ T + V + G IIG+GG +I +++G K+ I R+ L G+ E ++
Sbjct: 6 SVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDSGGLPERSCMLTGTPESVQ 65
Query: 223 QASAMVRELI 232
A ++ +++
Sbjct: 66 SAKRLLDQIV 75
|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 | Back information, alignment and structure |
|---|
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 | Back information, alignment and structure |
|---|
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 | Back information, alignment and structure |
|---|
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 34 | Back information, alignment and structure |
|---|
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 34 | Back information, alignment and structure |
|---|
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 34 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 134 | Back information, alignment and structure |
|---|
| >d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 290 | |||
| d1zzka1 | 75 | HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | 99.49 | |
| d1wvna1 | 70 | Poly(RC)-binding protein 1 {Human (Homo sapiens) [ | 99.47 | |
| d1j4wa1 | 74 | Far upstream binding element, FBP {Human (Homo sap | 99.46 | |
| d1m9oa_ | 40 | Tristetraproline (ttp, tis11, nup475) {Mouse (Mus | 99.45 | |
| d1rgoa1 | 36 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 99.43 | |
| d1j4wa2 | 71 | Far upstream binding element, FBP {Human (Homo sap | 99.38 | |
| d1x4na1 | 79 | Far upstream binding element, FBP {Mouse (Mus musc | 99.37 | |
| d1dtja_ | 74 | Neuro-oncological ventral antigen 2, nova-2, KH3 { | 99.37 | |
| d2axya1 | 71 | Poly(RC)-binding protein 2 {Human (Homo sapiens) [ | 99.36 | |
| d1x4ma1 | 81 | Far upstream binding element, FBP {Mouse (Mus musc | 99.32 | |
| d1m9oa_ | 40 | Tristetraproline (ttp, tis11, nup475) {Mouse (Mus | 99.28 | |
| d1we8a_ | 104 | Tudor and KH domain containing protein, Tdrkh {Mou | 99.25 | |
| d2ctla1 | 84 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.22 | |
| d1rgoa2 | 34 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 99.22 | |
| d1rgoa1 | 36 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 99.2 | |
| d2ctea1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.14 | |
| d1rgoa2 | 34 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 99.14 | |
| d2ctma1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.08 | |
| d2ctja1 | 82 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.03 | |
| d1viga_ | 71 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.03 | |
| d2cpqa1 | 78 | Fragile X mental retardation syndrome related prot | 98.99 | |
| d2ba0a3 | 84 | Exosome complex RNA-binding protein 1, ECR1 {Archa | 98.95 | |
| d2ctka1 | 91 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 98.94 | |
| d1tuaa1 | 84 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.77 | |
| d2ctfa1 | 90 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 98.7 | |
| d2je6i3 | 69 | Exosome complex RNA-binding protein 1, ECR1 {Sulfo | 98.47 | |
| d2z0sa2 | 87 | Exosome complex RNA-binding protein 1, ECR1 {Aerop | 98.42 | |
| d1e3ha4 | 54 | Polynucleotide phosphorylase/guanosine pentaphosph | 98.16 | |
| d1tuaa2 | 104 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.05 | |
| d2cqea2 | 29 | Zinc finger CCCH domain-containing protein C19orf7 | 98.01 | |
| d1k1ga_ | 122 | RNA splicing factor 1 {Human (Homo sapiens) [TaxId | 97.66 | |
| d2cqea2 | 29 | Zinc finger CCCH domain-containing protein C19orf7 | 97.47 | |
| d2bl5a1 | 134 | Quaking protein A (Xqua) {African clawed frog (Xen | 96.81 | |
| d2cqea1 | 56 | Zinc finger CCCH domain-containing protein C19orf7 | 96.35 | |
| d2cqea1 | 56 | Zinc finger CCCH domain-containing protein C19orf7 | 95.28 | |
| d2asba3 | 67 | Transcription factor NusA, C-terminal domains {Myc | 94.75 | |
| d1hh2p3 | 68 | Transcription factor NusA, C-terminal domains {The | 93.37 | |
| d2fc6a1 | 37 | Target of EGR1 protein 1, TOE1 {Human (Homo sapien | 89.1 | |
| d2fc6a1 | 37 | Target of EGR1 protein 1, TOE1 {Human (Homo sapien | 85.8 |
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: HnRNP K, KH3 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.49 E-value=1.2e-14 Score=103.61 Aligned_cols=73 Identities=30% Similarity=0.494 Sum_probs=68.2
Q ss_pred CCceEEEEecccccceeeCCCCCchhhHHHhhCCceeeccCCCCCCcceeEEcCCHHHHHHHHHHHHHHHHhc
Q 022928 163 ASATAKISVDASLAGAIIGKGGVNSKQICRQTGAKLSIRDHEADPNLRNIELEGSFEQIKQASAMVRELIVRI 235 (290)
Q Consensus 163 ~~~t~~i~VP~~~vg~iIGkgG~~Ik~i~~~sga~i~v~~~~~~~~~r~v~i~G~~~~i~~A~~~I~~~i~~~ 235 (290)
+..|.+|.||.+.+|.|||++|++|+.|++.||+.|+|.+...+..+|.+.|+|++++++.|+.+|.+.+.+.
T Consensus 2 p~~t~~i~VP~~~vg~iIG~~G~~I~~I~~~sga~I~i~~~~~~~~~r~i~I~G~~~~v~~A~~~I~~~i~e~ 74 (75)
T d1zzka1 2 PIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQY 74 (75)
T ss_dssp CCEEEEEEEETTTGGGGTCGGGHHHHHHHHHHCCEEEECCTTSCSSEEEEEEEECHHHHHHHHHHHHHHHHHH
T ss_pred CcEEEEEEEChHhcCeeECCCCchHHHHHhhcCCeEEEccCCCCCCceEEEEEeCHHHHHHHHHHHHHHHHhc
Confidence 4568899999999999999999999999999999999988777788999999999999999999999999874
|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fc6a1 g.66.1.1 (A:8-44) Target of EGR1 protein 1, TOE1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fc6a1 g.66.1.1 (A:8-44) Target of EGR1 protein 1, TOE1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|