Citrus Sinensis ID: 022951


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MSVLSRVWRARGSTAAATTTTTSLQTLIFLSRALSTSCENTGIDPKAKAGAAAALPLNNNNSKKKKEGKGEGKHVQWVFLGCPGVGKGTYASRLSNLLGVPHIATGDLLDEIVSQGKLVSDEIIINLLSKRLEAGEAKGEAGFILDGFPRTEILEGVTDIDLVINLKLREEALLAKCLGRRICSECGGNYNVACIDIKGENGNPGMYMGPLLPPPHCASKLITRSDDKEEVVRERLRIYNEKSRPVEEFYRRRGKLLEFDLPGGIPESWPKLLQALNLEDPEDKQSAAA
ccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHccccccccHHHHHHHHHccccccHHHHHHHHHHHHccccccccccCEcccccccHHHHHcccccEEEEEEccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHcccEEEECccccccHHHHHHHHHHccccccHHHHHcc
*********************TSLQTLIFLSRALSTS************************************HVQWVFLGCPGVGKGTYASRLSNLLGVPHIATGDLLDEIVSQGKLVSDEIIINLLSKRLEAGEAKGEAGFILDGFPRTEILEGVTDIDLVINLKLREEALLAKCLGRRICSECGGNYNVACIDIKGENGNPGMYMGPLLPPPHCASKLITRSDDKEEVVRERLRIYNEKSRPVEEFYRRRGKLLEFDLPGGIPESWPKLLQALN************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVLSRVWRARGSTAAATTTTTSLQTLIFLSRALSTSCENTGIDPKAKAGAAAALPLNNNNSKKKKEGKGEGKHVQWVFLGCPGVGKGTYASRLSNLLGVPHIATGDLLDEIVSQGKLVSDEIIINLLSKRLEAGEAKGEAGFILDGFPRTEILEGVTDIDLVINLKLREEALLAKCLGRRICSECGGNYNVACIDIKGENGNPGMYMGPLLPPPHCASKLITRSDDKEEVVRERLRIYNEKSRPVEEFYRRRGKLLEFDLPGGIPESWPKLLQALNLEDPEDKQSAAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable adenylate kinase 1, chloroplastic This small ubiquitous enzyme is essential for maintenance and cell growth.probableQ9ZUU1
Adenylate kinase, chloroplastic This small ubiquitous enzyme is essential for maintenance and cell growth.probableQ8HSW1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.4.-2,7,4'-trihydroxyisoflavanone 4'-O-methyltransferase.probable
2.7.4.3Adenylate kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GMT, chain A
Confidence level:very confident
Coverage over the Query: 76-193,207-261
View the alignment between query and template
View the model in PyMOL
Template: 2AK3, chain A
Confidence level:confident
Coverage over the Query: 80-205,217-289
View the alignment between query and template
View the model in PyMOL