Citrus Sinensis ID: 022956


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MSDRDGEPFVEVDPSGRFGRYSDLLGSGAVKKVYRAFDQEEGIEVAWNQVRLSHFSEDPVLVNRLHSEVQLLRTLKNKYIIVCYSVWLDDQHNTLNFITEVCTSGNLRTYRKKHRHVSIKALKKWSKQVLEGLEYLHTHEPCIIHRDLNCSNIFINGNIGQVKIGDLGFAAIVGRSHAAHSIIGTPEYMAPELYEEDYTEMVDIYSFGLCLLEMVTMEIPYSECDSVAKIYKKVTGGVKPQALNKVKDPEVKAFIEKCIAQPRARPSASELLKDPFFSELNDDDSEPSP
ccccccccccccccccccEEcccEEcccccccEEEEEEcccccEEEEEEECcccccccHHHHHHHHHHHHHHHHccccccEEEEEEEEEccccEEEEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccccccEEECccccCEEEECcHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccccccHHHHHccccccccccccccccc
************DP**RFGRYSDLLGSGAVKKVYRAFDQEEGIEVAWNQVRLSHFSEDPVLVNRLHSEVQLLRTLKNKYIIVCYSVWLDDQHNTLNFITEVCTSGNLRTYRKKHRHVSIKALKKWSKQVLEGLEYLHTHEPCIIHRDLNCSNIFINGNIGQVKIGDLGFAAIVGRSHAAHSIIGTPEYMAPELYEEDYTEMVDIYSFGLCLLEMVTMEIPYSECDSVAKIYKKVTGGVKPQALNKVKDPEVKAFIEKCIAQPRARPSASELLKDPFF************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDRDGEPFVEVDPSGRFGRYSDLLGSGAVKKVYRAFDQEEGIEVAWNQVRLSHFSEDPVLVNRLHSEVQLLRTLKNKYIIVCYSVWLDDQHNTLNFITEVCTSGNLRTYRKKHRHVSIKALKKWSKQVLEGLEYLHTHEPCIIHRDLNCSNIFINGNIGQVKIGDLGFAAIVGRSHAAHSIIGTPEYMAPELYEEDYTEMVDIYSFGLCLLEMVTMEIPYSECDSVAKIYKKVTGGVKPQALNKVKDPEVKAFIEKCIAQPRARPSASELLKDPFFSELNDDDSEPSP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable serine/threonine-protein kinase WNK11 May regulate flowering time by modulating the photoperiod pathway.confidentQ6ICW6
Probable serine/threonine-protein kinase WNK5 probableQ0D541

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3N9X, chain A
Confidence level:very confident
Coverage over the Query: 7-286
View the alignment between query and template
View the model in PyMOL