Query         022977
Match_columns 289
No_of_seqs    240 out of 1482
Neff          7.5 
Searched_HMMs 46136
Date          Fri Mar 29 07:32:48 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/022977.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/022977hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01657 Stress-antifung:  Salt  99.9 2.5E-25 5.4E-30  174.6   8.0   98   36-133     1-106 (106)
  2 PF01657 Stress-antifung:  Salt  99.9 3.7E-22   8E-27  156.6   7.9   85  153-237    16-106 (106)
  3 PF01102 Glycophorin_A:  Glycop  96.2  0.0021 4.6E-08   51.4   1.2   33  252-284    62-94  (122)
  4 PF08693 SKG6:  Transmembrane a  95.4    0.01 2.2E-07   37.9   1.9   15  256-270    14-28  (40)
  5 PF02439 Adeno_E3_CR2:  Adenovi  95.2    0.02 4.4E-07   35.9   2.6   21  256-276     5-25  (38)
  6 PF15102 TMEM154:  TMEM154 prot  91.8    0.13 2.8E-06   42.3   2.4   15  256-270    58-72  (146)
  7 PF08693 SKG6:  Transmembrane a  91.7   0.061 1.3E-06   34.3   0.4   27  252-278     6-33  (40)
  8 PTZ00382 Variant-specific surf  90.4    0.18   4E-06   38.6   2.0   21  251-271    63-83  (96)
  9 PF02009 Rifin_STEVOR:  Rifin/s  89.1    0.22 4.7E-06   46.1   1.7   15   52-66     35-49  (299)
 10 PF14610 DUF4448:  Protein of u  88.1    0.31 6.7E-06   41.9   2.0   27  254-280   157-183 (189)
 11 PF01034 Syndecan:  Syndecan do  87.4    0.17 3.7E-06   35.6  -0.0   20  255-274    10-29  (64)
 12 PF04478 Mid2:  Mid2 like cell   86.9    0.25 5.5E-06   40.9   0.7   21  256-276    51-71  (154)
 13 PF08374 Protocadherin:  Protoc  84.6     1.3 2.8E-05   38.7   4.0   22  256-278    40-61  (221)
 14 PF12669 P12:  Virus attachment  83.0     2.6 5.6E-05   29.2   4.2    6  259-264     2-7   (58)
 15 PF05568 ASFV_J13L:  African sw  82.3    0.94   2E-05   37.2   2.0   27  256-282    31-57  (189)
 16 PHA03265 envelope glycoprotein  82.0     1.3 2.7E-05   41.6   3.0   26  256-281   349-375 (402)
 17 PF04689 S1FA:  DNA binding pro  81.8     3.5 7.7E-05   29.0   4.4   22  249-270     8-29  (69)
 18 PF11857 DUF3377:  Domain of un  81.2     2.5 5.4E-05   30.7   3.6   26  251-276    26-51  (74)
 19 PF05454 DAG1:  Dystroglycan (D  80.2    0.54 1.2E-05   43.2   0.0    9  184-192   101-109 (290)
 20 PF01299 Lamp:  Lysosome-associ  78.5     0.7 1.5E-05   42.8   0.2   26  254-279   270-295 (306)
 21 PTZ00046 rifin; Provisional     78.0       1 2.2E-05   42.6   1.0   14   52-65     55-68  (358)
 22 PF11884 DUF3404:  Domain of un  78.0     1.1 2.3E-05   40.5   1.2   11  225-235   210-220 (262)
 23 TIGR01477 RIFIN variant surfac  77.3     1.1 2.4E-05   42.2   1.1   15   52-66     58-72  (353)
 24 PF15012 DUF4519:  Domain of un  76.1     0.9 1.9E-05   31.1   0.1   25  254-278    28-52  (56)
 25 PF12877 DUF3827:  Domain of un  73.8       4 8.7E-05   41.3   4.0   26   79-104    78-103 (684)
 26 PF08114 PMP1_2:  ATPase proteo  73.2       5 0.00011   25.6   2.9   13  271-283    24-36  (43)
 27 PF15345 TMEM51:  Transmembrane  71.6     8.5 0.00018   34.1   5.1   25  256-281    59-85  (233)
 28 KOG3488 Dolichol phosphate-man  69.9     5.3 0.00011   28.7   2.8   26  256-281    47-72  (81)
 29 KOG3653 Transforming growth fa  69.8      11 0.00023   37.2   5.7   13  226-238   123-135 (534)
 30 PF13268 DUF4059:  Protein of u  67.0     8.8 0.00019   27.6   3.5   19  269-287    20-38  (72)
 31 TIGR01478 STEVOR variant surfa  65.1     6.5 0.00014   35.9   3.1   15   51-65     57-71  (295)
 32 PTZ00370 STEVOR; Provisional    61.8     7.1 0.00015   35.8   2.7   14   51-64     56-69  (296)
 33 PF15099 PIRT:  Phosphoinositid  60.1     4.3 9.2E-05   32.6   0.9   30  256-285    79-111 (129)
 34 PF13908 Shisa:  Wnt and FGF in  59.5     6.9 0.00015   33.1   2.2    9  257-265    78-86  (179)
 35 PF02009 Rifin_STEVOR:  Rifin/s  55.6     7.2 0.00016   36.1   1.8    6  282-287   285-290 (299)
 36 KOG3637 Vitronectin receptor,   55.5      13 0.00027   40.4   3.8   27  254-280   976-1002(1030)
 37 PLN03150 hypothetical protein;  55.0      12 0.00027   38.1   3.5   26  256-281   546-571 (623)
 38 PF07297 DPM2:  Dolichol phosph  51.4      14 0.00031   27.2   2.4   15  256-270    45-59  (78)
 39 PF12768 Rax2:  Cortical protei  51.2      27 0.00058   32.0   4.8   19  253-271   226-244 (281)
 40 PF06697 DUF1191:  Protein of u  50.4       9 0.00019   35.0   1.5   13  256-268   212-224 (278)
 41 PF02480 Herpes_gE:  Alphaherpe  48.8     5.7 0.00012   38.8   0.0   14  187-200   237-250 (439)
 42 PRK01844 hypothetical protein;  47.2      11 0.00023   27.3   1.1   23  259-281     7-29  (72)
 43 PF12877 DUF3827:  Domain of un  45.2      21 0.00046   36.3   3.3   22  186-207   212-233 (684)
 44 PF05454 DAG1:  Dystroglycan (D  44.3     7.4 0.00016   35.9   0.0   11  267-277   161-171 (290)
 45 KOG1226 Integrin beta subunit   44.0      29 0.00063   36.0   4.1   29  253-281   710-738 (783)
 46 PF05808 Podoplanin:  Podoplani  43.8     7.6 0.00017   32.5   0.0   27  253-279   128-155 (162)
 47 PHA02650 hypothetical protein;  43.0      23 0.00051   26.0   2.4   19  271-289    63-81  (81)
 48 PF14914 LRRC37AB_C:  LRRC37A/B  42.9      16 0.00035   30.1   1.7   25  255-279   121-145 (154)
 49 TIGR02976 phageshock_pspB phag  42.7      30 0.00064   25.3   2.9   10  259-268     6-15  (75)
 50 PF15176 LRR19-TM:  Leucine-ric  42.3      25 0.00053   27.1   2.5   17  254-270    14-30  (102)
 51 PF04478 Mid2:  Mid2 like cell   42.1     7.4 0.00016   32.3  -0.3   28  254-281    45-73  (154)
 52 PF06697 DUF1191:  Protein of u  40.4      36 0.00079   31.2   3.8   22  248-269   207-229 (278)
 53 PF09835 DUF2062:  Uncharacteri  40.0      20 0.00043   29.4   1.9   11  277-287   143-153 (154)
 54 PF13908 Shisa:  Wnt and FGF in  40.0      17 0.00037   30.7   1.6   20  252-271    77-96  (179)
 55 PF06667 PspB:  Phage shock pro  38.8      40 0.00086   24.6   3.1   10  259-268     6-15  (75)
 56 PRK00523 hypothetical protein;  38.1      18 0.00039   26.2   1.1   24  258-281     7-30  (72)
 57 PF13955 Fst_toxin:  Toxin Fst,  38.1      20 0.00044   19.5   1.1   13  259-271     4-16  (21)
 58 PTZ00045 apical membrane antig  37.0      37 0.00079   34.2   3.5   15   94-108   207-221 (595)
 59 PF00558 Vpu:  Vpu protein;  In  36.8     8.5 0.00018   28.5  -0.7    6  261-266     7-12  (81)
 60 PF12191 stn_TNFRSF12A:  Tumour  36.2     8.4 0.00018   30.9  -0.8    7  278-284   101-107 (129)
 61 PF01708 Gemini_mov:  Geminivir  35.9 1.5E+02  0.0032   22.4   5.7   25  253-277    34-58  (91)
 62 PF07213 DAP10:  DAP10 membrane  35.5      29 0.00062   25.6   1.9   12  277-288    58-69  (79)
 63 PF05568 ASFV_J13L:  African sw  35.4      35 0.00076   28.2   2.6   14  258-271    29-42  (189)
 64 PTZ00087 thrombosponding-relat  35.3      46 0.00099   30.4   3.5   23  252-274   294-316 (340)
 65 PF03302 VSP:  Giardia variant-  34.8      31 0.00067   33.3   2.6   15  254-268   367-381 (397)
 66 TIGR01477 RIFIN variant surfac  34.4      21 0.00045   33.8   1.3   26   91-116   126-151 (353)
 67 PTZ00046 rifin; Provisional     34.2      21 0.00046   33.8   1.3   26   91-116   123-148 (358)
 68 COG3197 FixS Uncharacterized p  33.7      61  0.0013   22.4   3.1   16  256-271     3-18  (58)
 69 PF01102 Glycophorin_A:  Glycop  33.6      29 0.00063   27.8   1.8   29  260-288    66-95  (122)
 70 PF06365 CD34_antigen:  CD34/Po  33.5      69  0.0015   27.9   4.3    6  276-281   123-128 (202)
 71 PF02430 AMA-1:  Apical membran  32.9      14 0.00031   35.9   0.0   23  257-279   430-452 (471)
 72 PF08374 Protocadherin:  Protoc  32.8      28 0.00061   30.6   1.7   26  256-281    36-61  (221)
 73 PTZ00382 Variant-specific surf  32.2      22 0.00048   27.1   0.9    6  198-203    28-33  (96)
 74 COG1862 YajC Preprotein transl  32.0      13 0.00028   28.6  -0.4   10  271-280    20-29  (97)
 75 PRK15471 chain length determin  31.8      44 0.00095   31.3   3.0   23  246-268   285-307 (325)
 76 COG3763 Uncharacterized protei  31.6      20 0.00044   25.7   0.6   11  272-282    20-30  (71)
 77 PRK01821 hypothetical protein;  31.3      31 0.00068   28.0   1.7   14  276-289   117-130 (133)
 78 PF15431 TMEM190:  Transmembran  30.9      60  0.0013   25.5   3.1   20  264-283    68-87  (134)
 79 PF03229 Alpha_GJ:  Alphavirus   30.4      71  0.0015   25.3   3.4   28  254-281    83-111 (126)
 80 PF12606 RELT:  Tumour necrosis  29.3      61  0.0013   21.7   2.5   19  257-275     3-21  (50)
 81 PF06024 DUF912:  Nucleopolyhed  29.3     5.8 0.00013   30.6  -2.8   16  256-271    61-76  (101)
 82 PF14991 MLANA:  Protein melan-  28.8      16 0.00034   28.9  -0.4   11  270-280    40-50  (118)
 83 PF12768 Rax2:  Cortical protei  28.1      44 0.00095   30.7   2.3   26  256-281   233-258 (281)
 84 TIGR00739 yajC preprotein tran  27.7      21 0.00045   26.5   0.1    8  272-279    15-22  (84)
 85 TIGR01478 STEVOR variant surfa  27.6      73  0.0016   29.3   3.5   16  269-284   274-289 (295)
 86 PF05083 LST1:  LST-1 protein;   27.5      80  0.0017   22.7   3.0   20  266-285     8-27  (74)
 87 PHA03099 epidermal growth fact  26.4      39 0.00084   27.3   1.4    7  227-233    57-63  (139)
 88 PF04246 RseC_MucC:  Positive r  26.3      92   0.002   24.9   3.7   16  186-204     8-23  (135)
 89 PHA03265 envelope glycoprotein  26.3      93   0.002   29.5   4.0   35  253-288   350-385 (402)
 90 PF00974 Rhabdo_glycop:  Rhabdo  25.4      23 0.00051   35.2   0.0   15  184-198   341-355 (501)
 91 PF05393 Hum_adeno_E3A:  Human   25.3 1.1E+02  0.0024   23.1   3.5   11  261-271    37-47  (94)
 92 PTZ00370 STEVOR; Provisional    24.5      78  0.0017   29.1   3.2   15  269-283   270-284 (296)
 93 PF12575 DUF3753:  Protein of u  24.1      33 0.00071   24.8   0.6   19  258-276    50-68  (72)
 94 COG3765 WzzB Chain length dete  24.0      76  0.0016   30.0   3.0   24  244-267   305-328 (347)
 95 PTZ00230 variable surface prot  23.4 1.4E+02  0.0031   28.4   4.9   23  251-273   288-310 (364)
 96 PRK14766 lipoprotein signal pe  22.8      25 0.00053   30.7  -0.4   16  257-272   162-177 (201)
 97 PF05337 CSF-1:  Macrophage col  22.2      29 0.00064   31.6   0.0   28  256-283   227-254 (285)
 98 PF10883 DUF2681:  Protein of u  22.2      61  0.0013   24.4   1.7   15  261-275     7-21  (87)
 99 PF12301 CD99L2:  CD99 antigen   22.2      93   0.002   26.4   3.0   10  259-268   116-125 (169)
100 KOG1094 Discoidin domain recep  22.2      73  0.0016   32.6   2.7    8   45-52     42-49  (807)
101 PRK10381 LPS O-antigen length   20.3      90   0.002   29.8   2.9   26  244-269   327-352 (377)
102 PTZ00208 65 kDa invariant surf  20.1      18 0.00039   34.7  -1.9   11  217-227   316-326 (436)

No 1  
>PF01657 Stress-antifung:  Salt stress response/antifungal;  InterPro: IPR002902 This domain is found in plants and has no known function. The structure of this domain is known and it is thought to be involved in antifungal responses in plants []. Two copies of this domain are also found together in cysteine-rich protein kinases and cysteine-rich repeat secretory proteins. The domain contains four conserved cysteines.; PDB: 3A2E_D.
Probab=99.92  E-value=2.5e-25  Score=174.63  Aligned_cols=98  Identities=42%  Similarity=0.796  Sum_probs=75.3

Q ss_pred             ccCCC---CCCC-CCCChhHHHHHHHHHHHHhhhccC---CcceeeccC-CCcEEEEEecCCCCChhhHHHHHHHHHHHH
Q 022977           36 FGGCS---QQKY-TPGSAYENSVNSMLTSLVNSAMFS---SYNNFTIQG-QQTLYGLFQCRGDLSTADCGRCVAHAVSQL  107 (289)
Q Consensus        36 ~~~C~---~~~~-~~~s~f~~nl~~ll~~L~~~a~~~---~f~~~~~g~-~~~vYgl~qCr~Dls~~~C~~Cl~~a~~~~  107 (289)
                      |+.|+   +++| +++++|+.+++.||.+|+..++..   +|++...|. ++++|||+||++|+++++|..||+.++..+
T Consensus         1 ~~~Cs~~~~~~~~~~~~~f~~~l~~ll~~l~~~a~~~~~~~f~~~~~~~~~~~vYgl~qC~~Dls~~dC~~Cl~~a~~~~   80 (106)
T PF01657_consen    1 WHFCSSNTNNNYTTDNSTFEQNLNSLLSSLVSNAASSSSKGFATGSAGSGPDTVYGLAQCRGDLSPSDCRACLADAVANI   80 (106)
T ss_dssp             ---E---SSB----TT-THHHHHHHHHHHHHHHGGGTT-TEEEEEE--ST---EEEEEEE-TTS-HHHHHHHHHHHHCCH
T ss_pred             CCcCCCCCCCCcCCCCchHHHHHHHHHHHHHHHHhhccccCcEEeecCCCCCeEEEEEEcCCCCChhhhHHHHHHHHHHH
Confidence            67899   3566 578889999999999999998763   577776666 899999999999999999999999999999


Q ss_pred             hhhCCCCceEEEEcCeEEEEEccCcc
Q 022977          108 GTLCLDSCGGVLQLDGCFVKYDNISF  133 (289)
Q Consensus       108 ~~~C~~~~~a~i~~~~C~lRYs~~~F  133 (289)
                      ++.|+.++||+||+++|+||||+++|
T Consensus        81 ~~~C~~~~g~~v~~~~C~lRY~~~~F  106 (106)
T PF01657_consen   81 SSCCPGSRGGRVWYDSCFLRYENYPF  106 (106)
T ss_dssp             HHHTTSBSSEEEEESSEEEEEESS--
T ss_pred             HHhCCCCceEEEECCCEEEEEECCCC
Confidence            99999999999999999999999998


No 2  
>PF01657 Stress-antifung:  Salt stress response/antifungal;  InterPro: IPR002902 This domain is found in plants and has no known function. The structure of this domain is known and it is thought to be involved in antifungal responses in plants []. Two copies of this domain are also found together in cysteine-rich protein kinases and cysteine-rich repeat secretory proteins. The domain contains four conserved cysteines.; PDB: 3A2E_D.
Probab=99.87  E-value=3.7e-22  Score=156.61  Aligned_cols=85  Identities=33%  Similarity=0.633  Sum_probs=68.3

Q ss_pred             ChhHHHHHHHHHHHhhhcCC--CCCCeeec----CCCcEEEEEEcCCCCChhhHHHHHHHHHHHhhhhCCCCcceEEEcC
Q 022977          153 DSDASTRRDAVLGYLGSSDG--SYKPYRVG----GSGDVTGVAQCVGDLSASECQDCLSDAIGRLKTDCGAAKWGDMFLA  226 (289)
Q Consensus       153 ~~~f~~~~~~ll~~l~~~~~--~~~~f~~~----~~~~vYglaQC~~DLs~~~C~~CL~~a~~~i~~~c~~~~ggri~~~  226 (289)
                      ++.|++++.+||..|...+.  .+.+|+++    +.++||||+||++||++++|..||+.++.+++++|+.++||+|+++
T Consensus        16 ~~~f~~~l~~ll~~l~~~a~~~~~~~f~~~~~~~~~~~vYgl~qC~~Dls~~dC~~Cl~~a~~~~~~~C~~~~g~~v~~~   95 (106)
T PF01657_consen   16 NSTFEQNLNSLLSSLVSNAASSSSKGFATGSAGSGPDTVYGLAQCRGDLSPSDCRACLADAVANISSCCPGSRGGRVWYD   95 (106)
T ss_dssp             T-THHHHHHHHHHHHHHHGGGTT-TEEEEEE--ST---EEEEEEE-TTS-HHHHHHHHHHHHCCHHHHTTSBSSEEEEES
T ss_pred             CchHHHHHHHHHHHHHHHHhhccccCcEEeecCCCCCeEEEEEEcCCCCChhhhHHHHHHHHHHHHHhCCCCceEEEECC
Confidence            45699999999999975422  12568775    4668999999999999999999999999999999999999999999


Q ss_pred             CeeEEEccCCC
Q 022977          227 KCYARYSEGGD  237 (289)
Q Consensus       227 ~C~lRYe~~~f  237 (289)
                      +|+||||+++|
T Consensus        96 ~C~lRY~~~~F  106 (106)
T PF01657_consen   96 SCFLRYENYPF  106 (106)
T ss_dssp             SEEEEEESS--
T ss_pred             CEEEEEECCCC
Confidence            99999999987


No 3  
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=96.17  E-value=0.0021  Score=51.42  Aligned_cols=33  Identities=21%  Similarity=0.383  Sum_probs=21.3

Q ss_pred             CcceEEEEehHHHHHHHHHHHHHHHHHHHhhcC
Q 022977          252 EIEKTLAILIGMIAGIALLVIFLSSIRRLCDGK  284 (289)
Q Consensus       252 ~~~~~~~Ivv~~~~~~~~~~~~~~~~~~~~~~~  284 (289)
                      +...++.||+|++++++++|+++.|+.||++||
T Consensus        62 s~~~i~~Ii~gv~aGvIg~Illi~y~irR~~Kk   94 (122)
T PF01102_consen   62 SEPAIIGIIFGVMAGVIGIILLISYCIRRLRKK   94 (122)
T ss_dssp             S-TCHHHHHHHHHHHHHHHHHHHHHHHHHHS--
T ss_pred             cccceeehhHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            345578899999999887776665554444443


No 4  
>PF08693 SKG6:  Transmembrane alpha-helix domain;  InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ]. This entry represents the highly conserved transmembrane alpha-helical domain found in these proteins [, ]. The full-length AXL2 protein has a negative regulatory function in cytokinesis [].
Probab=95.45  E-value=0.01  Score=37.88  Aligned_cols=15  Identities=13%  Similarity=0.246  Sum_probs=7.8

Q ss_pred             EEEEehHHHHHHHHH
Q 022977          256 TLAILIGMIAGIALL  270 (289)
Q Consensus       256 ~~~Ivv~~~~~~~~~  270 (289)
                      .++++||+++.++++
T Consensus        14 a~~VvVPV~vI~~vl   28 (40)
T PF08693_consen   14 AVGVVVPVGVIIIVL   28 (40)
T ss_pred             EEEEEechHHHHHHH
Confidence            355567765543333


No 5  
>PF02439 Adeno_E3_CR2:  Adenovirus E3 region protein CR2;  InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host []. This region called CR1 (conserved region 1) [] is found three times in Human adenovirus 19 (a subgroup D adenovirus) 49 kDa protein in the E3 region. CR1 is also found in the 20.1 Kd protein of subgroup B adenoviruses. The function of this 80 amino acid region is unknown. This region is probably a divergent immunoglobulin domain.
Probab=95.17  E-value=0.02  Score=35.88  Aligned_cols=21  Identities=29%  Similarity=0.705  Sum_probs=16.6

Q ss_pred             EEEEehHHHHHHHHHHHHHHH
Q 022977          256 TLAILIGMIAGIALLVIFLSS  276 (289)
Q Consensus       256 ~~~Ivv~~~~~~~~~~~~~~~  276 (289)
                      +++||++++++++++++++++
T Consensus         5 ~IaIIv~V~vg~~iiii~~~~   25 (38)
T PF02439_consen    5 TIAIIVAVVVGMAIIIICMFY   25 (38)
T ss_pred             hhhHHHHHHHHHHHHHHHHHH
Confidence            688999999998877765554


No 6  
>PF15102 TMEM154:  TMEM154 protein family
Probab=91.75  E-value=0.13  Score=42.30  Aligned_cols=15  Identities=40%  Similarity=0.518  Sum_probs=9.6

Q ss_pred             EEEEehHHHHHHHHH
Q 022977          256 TLAILIGMIAGIALL  270 (289)
Q Consensus       256 ~~~Ivv~~~~~~~~~  270 (289)
                      ++.|+||.|+.++|+
T Consensus        58 iLmIlIP~VLLvlLL   72 (146)
T PF15102_consen   58 ILMILIPLVLLVLLL   72 (146)
T ss_pred             EEEEeHHHHHHHHHH
Confidence            788889955444333


No 7  
>PF08693 SKG6:  Transmembrane alpha-helix domain;  InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ]. This entry represents the highly conserved transmembrane alpha-helical domain found in these proteins [, ]. The full-length AXL2 protein has a negative regulatory function in cytokinesis [].
Probab=91.75  E-value=0.061  Score=34.32  Aligned_cols=27  Identities=22%  Similarity=0.471  Sum_probs=19.7

Q ss_pred             CcceEEEEehHHHHHHHHHHHHH-HHHH
Q 022977          252 EIEKTLAILIGMIAGIALLVIFL-SSIR  278 (289)
Q Consensus       252 ~~~~~~~Ivv~~~~~~~~~~~~~-~~~~  278 (289)
                      +..+.++|.+++++.++++++.+ .|+.
T Consensus         6 ~~~~~vaIa~~VvVPV~vI~~vl~~~l~   33 (40)
T PF08693_consen    6 SNSNTVAIAVGVVVPVGVIIIVLGAFLF   33 (40)
T ss_pred             CCCceEEEEEEEEechHHHHHHHHHHhh
Confidence            44568999999999987776554 4444


No 8  
>PTZ00382 Variant-specific surface protein (VSP); Provisional
Probab=90.42  E-value=0.18  Score=38.64  Aligned_cols=21  Identities=19%  Similarity=0.164  Sum_probs=13.5

Q ss_pred             CCcceEEEEehHHHHHHHHHH
Q 022977          251 EEIEKTLAILIGMIAGIALLV  271 (289)
Q Consensus       251 ~~~~~~~~Ivv~~~~~~~~~~  271 (289)
                      .+.+.|..|+|++++++.+++
T Consensus        63 ls~gaiagi~vg~~~~v~~lv   83 (96)
T PTZ00382         63 LSTGAIAGISVAVVAVVGGLV   83 (96)
T ss_pred             cccccEEEEEeehhhHHHHHH
Confidence            345568888888766554444


No 9  
>PF02009 Rifin_STEVOR:  Rifin/stevor family;  InterPro: IPR002858 Malaria is still a major cause of mortality in many areas of the world. Plasmodium falciparum causes the most severe human form of the disease and is responsible for most fatalities. Severe cases of malaria can occur when the parasite invades and then proliferates within red blood cell erythrocytes. The parasite produces many variant antigenic proteins, encoded by multigene families, which are present on the surface of the infected erythrocyte and play important roles in virulence. A crucial survival mechanism for the malaria parasite is its ability to evade the immune response by switching these variant surface antigens. The high virulence of P. falciparum relative to other malarial parasites is in large part due to the fact that in this organism many of these surface antigens mediate the binding of infected erythrocytes to the vascular endothelium (cytoadherence) and non-infected erythrocytes (rosetting). This can lead to the accumulation of infected cells in the vasculature of a variety of organs, blocking the blood flow and reducing the oxygen supply. Clinical symptoms of severe infection can include fever, progressive anaemia, multi-organ dysfunction and coma. For more information see []. Several multicopy gene families have been described in Plasmodium falciparum, including the stevor family of subtelomeric open reading frames and the rif interspersed repetitive elements. Both families contain three predicted transmembrane segments. It has been proposed that stevor and rif are members of a larger superfamily that code for variant surface antigens [].
Probab=89.06  E-value=0.22  Score=46.07  Aligned_cols=15  Identities=7%  Similarity=0.177  Sum_probs=10.2

Q ss_pred             HHHHHHHHHHHhhhc
Q 022977           52 NSVNSMLTSLVNSAM   66 (289)
Q Consensus        52 ~nl~~ll~~L~~~a~   66 (289)
                      ...++++...-..++
T Consensus        35 PeMK~Vme~F~rqTs   49 (299)
T PF02009_consen   35 PEMKSVMENFDRQTS   49 (299)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            567777777766654


No 10 
>PF14610 DUF4448:  Protein of unknown function (DUF4448)
Probab=88.06  E-value=0.31  Score=41.89  Aligned_cols=27  Identities=15%  Similarity=0.181  Sum_probs=18.1

Q ss_pred             ceEEEEehHHHHHHHHHHHHHHHHHHH
Q 022977          254 EKTLAILIGMIAGIALLVIFLSSIRRL  280 (289)
Q Consensus       254 ~~~~~Ivv~~~~~~~~~~~~~~~~~~~  280 (289)
                      ...++|+||++++++++++.++++|.|
T Consensus       157 ~~~laI~lPvvv~~~~~~~~~~~~~~R  183 (189)
T PF14610_consen  157 KYALAIALPVVVVVLALIMYGFFFWNR  183 (189)
T ss_pred             ceeEEEEccHHHHHHHHHHHhhheeec
Confidence            347999999988776666544444433


No 11 
>PF01034 Syndecan:  Syndecan domain;  InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ]. Structurally, these proteins consist of four separate domains:   A signal sequence; An extracellular domain (ectodomain) of variable length whose sequence is not evolutionary conserved in the various forms of syndecans. The ectodomain contains the sites of attachment of the heparan sulphate glycosaminoglycan side chains;  A transmembrane region;  A highly conserved cytoplasmic domain of about 30 to 35 residues, which could interact with cytoskeletal proteins.    The proteins known to belong to this family are:    Syndecan 1.  Syndecan 2 or fibroglycan.  Syndecan 3 or neuroglycan or N-syndecan.  Syndecan 4 or amphiglycan or ryudocan.  Drosophila syndecan.   Caenorhabditis elegans probable syndecan (F57C7.3).    Syndecan-4, a transmembrane heparan sulphate proteoglycan, is a coreceptor with integrins in cell adhesion. It has been suggested to form a ternary signalling complex with protein kinase Calpha and phosphatidylinositol 4,5-bisphosphate (PIP2). Structural studies have demonstrated that the cytoplasmic domain undergoes a conformational transition and forms a symmetric dimer in the presence of phospholipid activator PIP2, and whose overall structure in solution exhibits a twisted clamp shape having a cavity in the centre of dimeric interface. In addition, it has been observed that the syndecan-4 variable domain interacts, strongly, not only with fatty acyl groups but also the anionic head group of PIP2. These findings indicate that PIP2 promotes oligomerisation of the syndecan-4 cytoplasmic domain for transmembrane signalling and cell-matrix adhesion [, ].; GO: 0008092 cytoskeletal protein binding, 0016020 membrane; PDB: 1EJQ_B 1EJP_B 1YBO_C 1OBY_Q.
Probab=87.40  E-value=0.17  Score=35.59  Aligned_cols=20  Identities=15%  Similarity=0.489  Sum_probs=0.0

Q ss_pred             eEEEEehHHHHHHHHHHHHH
Q 022977          255 KTLAILIGMIAGIALLVIFL  274 (289)
Q Consensus       255 ~~~~Ivv~~~~~~~~~~~~~  274 (289)
                      ...++|.++++++++.++++
T Consensus        10 vlaavIaG~Vvgll~ailLI   29 (64)
T PF01034_consen   10 VLAAVIAGGVVGLLFAILLI   29 (64)
T ss_dssp             --------------------
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            35667777766655444333


No 12 
>PF04478 Mid2:  Mid2 like cell wall stress sensor;  InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region. The remainder of the protein sequence is serine-rich and of low complexity, and is therefore impossible to align accurately. Mid2 is thought to act as a mechanosensor of cell wall stress. The C-terminal cytoplasmic region of Mid2 is known to interact with Rom2, a guanine nucleotide exchange factor (GEF) for Rho1, which is part of the cell wall integrity signalling pathway [].
Probab=86.93  E-value=0.25  Score=40.88  Aligned_cols=21  Identities=19%  Similarity=0.320  Sum_probs=11.6

Q ss_pred             EEEEehHHHHHHHHHHHHHHH
Q 022977          256 TLAILIGMIAGIALLVIFLSS  276 (289)
Q Consensus       256 ~~~Ivv~~~~~~~~~~~~~~~  276 (289)
                      +|-+||||-+++++++++++|
T Consensus        51 VIGvVVGVGg~ill~il~lvf   71 (154)
T PF04478_consen   51 VIGVVVGVGGPILLGILALVF   71 (154)
T ss_pred             EEEEEecccHHHHHHHHHhhe
Confidence            566677765555544444444


No 13 
>PF08374 Protocadherin:  Protocadherin;  InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains. They are expressed in a variety of organisms and are found in high concentrations in the brain where they seem to be localised mainly at cell-cell contact sites. Their expression seems to be developmentally regulated []. 
Probab=84.65  E-value=1.3  Score=38.75  Aligned_cols=22  Identities=27%  Similarity=0.605  Sum_probs=10.5

Q ss_pred             EEEEehHHHHHHHHHHHHHHHHH
Q 022977          256 TLAILIGMIAGIALLVIFLSSIR  278 (289)
Q Consensus       256 ~~~Ivv~~~~~~~~~~~~~~~~~  278 (289)
                      +++||.|+++++ |+|++..++|
T Consensus        40 ~iaiVAG~~tVI-LVI~i~v~vR   61 (221)
T PF08374_consen   40 MIAIVAGIMTVI-LVIFIVVLVR   61 (221)
T ss_pred             eeeeecchhhhH-HHHHHHHHHH
Confidence            456666655433 3333333444


No 14 
>PF12669 P12:  Virus attachment protein p12 family
Probab=82.99  E-value=2.6  Score=29.19  Aligned_cols=6  Identities=67%  Similarity=1.326  Sum_probs=2.6

Q ss_pred             EehHHH
Q 022977          259 ILIGMI  264 (289)
Q Consensus       259 Ivv~~~  264 (289)
                      |||+++
T Consensus         2 iII~~I    7 (58)
T PF12669_consen    2 IIIGII    7 (58)
T ss_pred             eeHHHH
Confidence            444443


No 15 
>PF05568 ASFV_J13L:  African swine fever virus J13L protein;  InterPro: IPR008385 This family consists of several African swine fever virus (ASFV) j13L proteins [, , ].
Probab=82.26  E-value=0.94  Score=37.16  Aligned_cols=27  Identities=15%  Similarity=0.293  Sum_probs=15.3

Q ss_pred             EEEEehHHHHHHHHHHHHHHHHHHHhh
Q 022977          256 TLAILIGMIAGIALLVIFLSSIRRLCD  282 (289)
Q Consensus       256 ~~~Ivv~~~~~~~~~~~~~~~~~~~~~  282 (289)
                      ...|+|+|++.++++++.++|+.+|+|
T Consensus        31 m~tILiaIvVliiiiivli~lcssRKk   57 (189)
T PF05568_consen   31 MYTILIAIVVLIIIIIVLIYLCSSRKK   57 (189)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhhH
Confidence            345667777666655555555444443


No 16 
>PHA03265 envelope glycoprotein D; Provisional
Probab=82.01  E-value=1.3  Score=41.55  Aligned_cols=26  Identities=31%  Similarity=0.363  Sum_probs=12.0

Q ss_pred             EEEEehH-HHHHHHHHHHHHHHHHHHh
Q 022977          256 TLAILIG-MIAGIALLVIFLSSIRRLC  281 (289)
Q Consensus       256 ~~~Ivv~-~~~~~~~~~~~~~~~~~~~  281 (289)
                      .+-|+|| .+++++++-+++++.|||+
T Consensus       349 ~~g~~ig~~i~glv~vg~il~~~~rr~  375 (402)
T PHA03265        349 FVGISVGLGIAGLVLVGVILYVCLRRK  375 (402)
T ss_pred             ccceEEccchhhhhhhhHHHHHHhhhh
Confidence            3334443 3445554444444555544


No 17 
>PF04689 S1FA:  DNA binding protein S1FA;  InterPro: IPR006779  S1FA is an unusual small plant peptide of only 70 amino acids with a basic domain which contains a nuclear localization signal and a putative DNA binding helix. S1FA is highly conserved between dicotyledonous and monocotyledonous plants and may be a DNA-binding protein that specifically recognises the negative promoter element S1F [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=81.83  E-value=3.5  Score=28.96  Aligned_cols=22  Identities=5%  Similarity=0.033  Sum_probs=12.6

Q ss_pred             CCCCcceEEEEehHHHHHHHHH
Q 022977          249 NDEEIEKTLAILIGMIAGIALL  270 (289)
Q Consensus       249 ~~~~~~~~~~Ivv~~~~~~~~~  270 (289)
                      ++-+.+.|+.|+|+-++.++++
T Consensus         8 KGlnPGlIVLlvV~g~ll~flv   29 (69)
T PF04689_consen    8 KGLNPGLIVLLVVAGLLLVFLV   29 (69)
T ss_pred             cCCCCCeEEeehHHHHHHHHHH
Confidence            4445566777777665544433


No 18 
>PF11857 DUF3377:  Domain of unknown function (DUF3377);  InterPro: IPR021805  This domain is functionally uncharacterised and found at the C terminus of peptidases belonging to MEROPS peptidase family M10A, membrane-type matrix metallopeptidases (clan MA). ; GO: 0004222 metalloendopeptidase activity
Probab=81.16  E-value=2.5  Score=30.68  Aligned_cols=26  Identities=15%  Similarity=0.331  Sum_probs=18.6

Q ss_pred             CCcceEEEEehHHHHHHHHHHHHHHH
Q 022977          251 EEIEKTLAILIGMIAGIALLVIFLSS  276 (289)
Q Consensus       251 ~~~~~~~~Ivv~~~~~~~~~~~~~~~  276 (289)
                      .+..+.++||||.+.++.++++.+..
T Consensus        26 ~~~~~avaVviPl~L~LCiLvl~yai   51 (74)
T PF11857_consen   26 GGTVNAVAVVIPLVLLLCILVLIYAI   51 (74)
T ss_pred             CCceeEEEEeHHHHHHHHHHHHHHHh
Confidence            34455899999998887777655543


No 19 
>PF05454 DAG1:  Dystroglycan (Dystrophin-associated glycoprotein 1);  InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5.5 kb transcript in Homo sapiens. The protein product is cleaved into two non-covalently associated subunits, [alpha] (N-terminal) and [beta] (C-terminal). In skeletal muscle the dystroglycan complex works as a transmembrane linkage between the extracellular matrix and the cytoskeleton [alpha]-dystroglycan is extracellular and binds to merosin ([alpha]-2 laminin) in the basement membrane, while [beta]-dystroglycan is a transmembrane protein and binds to dystrophin, which is a large rod-like cytoskeletal protein, absent in Duchenne muscular dystrophy patients. Dystrophin binds to intracellular actin cables. In this way, the dystroglycan complex, which links the extracellular matrix to the intracellular actin cables, is thought to provide structural integrity in muscle tissues. The dystroglycan complex is also known to serve as an agrin receptor in muscle, where it may regulate agrin-induced acetylcholine receptor clustering at the neuromuscular junction. There is also evidence which suggests the function of dystroglycan as a part of the signal transduction pathway because it is shown that Grb2, a mediator of the Ras-related signal pathway, can interact with the cytoplasmic domain of dystroglycan. In general, aberrant expression of dystrophin-associated protein complex underlies the pathogenesis of Duchenne muscular dystrophy, Becker muscular dystrophy and severe childhood autosomal recessive muscular dystrophy. Interestingly, no genetic disease has been described for either [alpha]- or [beta]-dystroglycan. Dystroglycan is widely distributed in non-muscle tissues as well as in muscle tissues. During epithelial morphogenesis of kidney, the dystroglycan complex is shown to act as a receptor for the basement membrane. Dystroglycan expression in Mus musculus brain and neural retina has also been reported. However, the physiological role of dystroglycan in non-muscle tissues has remained unclear [].; PDB: 1EG4_P.
Probab=80.25  E-value=0.54  Score=43.24  Aligned_cols=9  Identities=22%  Similarity=0.575  Sum_probs=0.0

Q ss_pred             cEEEEEEcC
Q 022977          184 DVTGVAQCV  192 (289)
Q Consensus       184 ~vYglaQC~  192 (289)
                      ++.++.+|.
T Consensus       101 sv~~~G~C~  109 (290)
T PF05454_consen  101 SVIPIGSCQ  109 (290)
T ss_dssp             ---------
T ss_pred             EEEEeeccC
Confidence            566777776


No 20 
>PF01299 Lamp:  Lysosome-associated membrane glycoprotein (Lamp);  InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear. Structurally, the lamp proteins consist of two internally homologous lysosome-luminal domains separated by a proline-rich hinge region; at the C-terminal extremity there is a transmembrane region (TM) followed by a very short cytoplasmic tail (C). In each of the duplicated domains, there are two conserved disulphide bonds. This structure is schematically represented in the figure below.   +-----+ +-----+ +-----+ +-----+ | | | | | | | | xCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxxxCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxx +--------------------------++Hinge++--------------------------++TM++C+  In mammals, there are two closely related types of lamp: lamp-1 and lamp-2, which form major components of the lysosome membrane. In chicken lamp-1 is known as LEP100.  Also included in this entry is the macrophage protein CD68 (or macrosialin) [] is a heavily glycosylated integral membrane protein whose structure consists of a mucin-like domain followed by a proline-rich hinge; a single lamp-like domain; a transmembrane region and a short cytoplasmic tail.   Similar to CD68, mammalian lamp-3, which is expressed in lymphoid organs, dendritic cells and in lung, contains all the C-terminal regions but lacks the N-terminal lamp-like region []. In a lamp-family protein from nematodes [] only the part C-terminal to the hinge is conserved. ; GO: 0016020 membrane
Probab=78.50  E-value=0.7  Score=42.79  Aligned_cols=26  Identities=12%  Similarity=0.277  Sum_probs=15.2

Q ss_pred             ceEEEEehHHHHHHHHHHHHHHHHHH
Q 022977          254 EKTLAILIGMIAGIALLVIFLSSIRR  279 (289)
Q Consensus       254 ~~~~~Ivv~~~~~~~~~~~~~~~~~~  279 (289)
                      ..++.|+||++++++++|+++.|+..
T Consensus       270 ~~~vPIaVG~~La~lvlivLiaYli~  295 (306)
T PF01299_consen  270 SDLVPIAVGAALAGLVLIVLIAYLIG  295 (306)
T ss_pred             cchHHHHHHHHHHHHHHHHHHhheeE
Confidence            45677778876665555544444333


No 21 
>PTZ00046 rifin; Provisional
Probab=78.04  E-value=1  Score=42.55  Aligned_cols=14  Identities=7%  Similarity=0.223  Sum_probs=7.0

Q ss_pred             HHHHHHHHHHHhhh
Q 022977           52 NSVNSMLTSLVNSA   65 (289)
Q Consensus        52 ~nl~~ll~~L~~~a   65 (289)
                      ...++++...-...
T Consensus        55 PeMK~Vme~F~rqT   68 (358)
T PTZ00046         55 PEMKSVMENFDRQT   68 (358)
T ss_pred             HHHHHHHHHHhHHH
Confidence            34555555554443


No 22 
>PF11884 DUF3404:  Domain of unknown function (DUF3404);  InterPro: IPR021821  This domain is functionally uncharacterised. This domain is found in bacteria. This presumed domain is about 260 amino acids in length. This domain is found associated with PF02518 from PFAM, PF00512 from PFAM. 
Probab=78.02  E-value=1.1  Score=40.54  Aligned_cols=11  Identities=27%  Similarity=0.652  Sum_probs=8.8

Q ss_pred             cCCeeEEEccC
Q 022977          225 LAKCYARYSEG  235 (289)
Q Consensus       225 ~~~C~lRYe~~  235 (289)
                      +.+|++||.+-
T Consensus       210 ~~sC~~r~gNl  220 (262)
T PF11884_consen  210 GNSCFVRYGNL  220 (262)
T ss_pred             CCcccceecce
Confidence            46899999963


No 23 
>TIGR01477 RIFIN variant surface antigen, rifin family. This model represents the rifin branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of rifin sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 20 bits.
Probab=77.30  E-value=1.1  Score=42.18  Aligned_cols=15  Identities=7%  Similarity=0.162  Sum_probs=7.8

Q ss_pred             HHHHHHHHHHHhhhc
Q 022977           52 NSVNSMLTSLVNSAM   66 (289)
Q Consensus        52 ~nl~~ll~~L~~~a~   66 (289)
                      ...++++...-...+
T Consensus        58 PeMK~Vm~nF~rqTs   72 (353)
T TIGR01477        58 PEMKSVMEQFDRQTS   72 (353)
T ss_pred             HHHHHHHHHHhHHHH
Confidence            445556655554443


No 24 
>PF15012 DUF4519:  Domain of unknown function (DUF4519)
Probab=76.13  E-value=0.9  Score=31.09  Aligned_cols=25  Identities=12%  Similarity=0.486  Sum_probs=18.9

Q ss_pred             ceEEEEehHHHHHHHHHHHHHHHHH
Q 022977          254 EKTLAILIGMIAGIALLVIFLSSIR  278 (289)
Q Consensus       254 ~~~~~Ivv~~~~~~~~~~~~~~~~~  278 (289)
                      .++.-||+|++++++++|+.+.|+.
T Consensus        28 ~kv~tVVlP~l~~~~~~Ivv~vy~k   52 (56)
T PF15012_consen   28 QKVFTVVLPTLAAVFLFIVVFVYLK   52 (56)
T ss_pred             HhheeEehhHHHHHHHHHhheeEEe
Confidence            4478899999988888777666543


No 25 
>PF12877 DUF3827:  Domain of unknown function (DUF3827);  InterPro: IPR024606 The function of the proteins in this entry is not currently known, but one of the human proteins (Q9HCM3 from SWISSPROT) has been implicated in pilocytic astrocytomas [, , ]. In the majority of cases of pilocytic astrocytomas a tandem duplication produces an in-frame fusion of the gene encoding this protein and the BRAF oncogene. The resulting fusion protein has constitutive BRAF kinase activity and is capable of transforming cells. 
Probab=73.82  E-value=4  Score=41.27  Aligned_cols=26  Identities=12%  Similarity=0.161  Sum_probs=18.6

Q ss_pred             CcEEEEEecCCCCChhhHHHHHHHHH
Q 022977           79 QTLYGLFQCRGDLSTADCGRCVAHAV  104 (289)
Q Consensus        79 ~~vYgl~qCr~Dls~~~C~~Cl~~a~  104 (289)
                      +-+|+..-=++-|+.++=..=|....
T Consensus        78 ~i~~aVr~~~~~LnGt~~S~lL~~Ls  103 (684)
T PF12877_consen   78 SITYAVRNGSGFLNGTEVSELLRQLS  103 (684)
T ss_pred             EEEEEEecCceeeccHHHHHHHHhhh
Confidence            56899988888888887555554443


No 26 
>PF08114 PMP1_2:  ATPase proteolipid family;  InterPro: IPR012589 This family consists of small proteolipids associated with the plasma membrane H+ ATPase. Two proteolipids (PMP1 and PMP2) are associated with the ATPase and both genes are similarly expressed in the wild-type strain of yeast. No modification of the level of transcription of one PMP gene is detected in a strain deleted of the other. Though both proteolipids show similarity with other small proteolipids associated with other cation -transporting ATPases, their functions remain unclear [].
Probab=73.24  E-value=5  Score=25.64  Aligned_cols=13  Identities=15%  Similarity=0.146  Sum_probs=6.4

Q ss_pred             HHHHHHHHHHhhc
Q 022977          271 VIFLSSIRRLCDG  283 (289)
Q Consensus       271 ~~~~~~~~~~~~~  283 (289)
                      +++.+.+||+..|
T Consensus        24 iva~~iYRKw~aR   36 (43)
T PF08114_consen   24 IVALFIYRKWQAR   36 (43)
T ss_pred             HHHHHHHHHHHHH
Confidence            4444445666433


No 27 
>PF15345 TMEM51:  Transmembrane protein 51
Probab=71.61  E-value=8.5  Score=34.13  Aligned_cols=25  Identities=32%  Similarity=0.349  Sum_probs=12.3

Q ss_pred             EEEEehHHHHHHHHHH--HHHHHHHHHh
Q 022977          256 TLAILIGMIAGIALLV--IFLSSIRRLC  281 (289)
Q Consensus       256 ~~~Ivv~~~~~~~~~~--~~~~~~~~~~  281 (289)
                      +||.|+..+ ++++++  +|+....||+
T Consensus        59 SVAyVLVG~-Gv~LLLLSICL~IR~KRr   85 (233)
T PF15345_consen   59 SVAYVLVGS-GVALLLLSICLSIRDKRR   85 (233)
T ss_pred             EEEEehhhH-HHHHHHHHHHHHHHHHHH
Confidence            567665444 333333  5555544443


No 28 
>KOG3488 consensus Dolichol phosphate-mannose regulatory protein (DPM2) [Posttranslational modification, protein turnover, chaperones]
Probab=69.94  E-value=5.3  Score=28.66  Aligned_cols=26  Identities=31%  Similarity=0.338  Sum_probs=16.1

Q ss_pred             EEEEehHHHHHHHHHHHHHHHHHHHh
Q 022977          256 TLAILIGMIAGIALLVIFLSSIRRLC  281 (289)
Q Consensus       256 ~~~Ivv~~~~~~~~~~~~~~~~~~~~  281 (289)
                      -.+|.+|+.+++.++.+.-.|+.-.+
T Consensus        47 ~yAi~iPvaagl~ll~lig~Fis~vM   72 (81)
T KOG3488|consen   47 EYAITIPVAAGLFLLCLIGTFISLVM   72 (81)
T ss_pred             hHHhhhHHHHHHHHHHHHHHHHHHHh
Confidence            46788999887765544334444444


No 29 
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms]
Probab=69.78  E-value=11  Score=37.20  Aligned_cols=13  Identities=23%  Similarity=0.235  Sum_probs=8.3

Q ss_pred             CCeeEEEccCCCC
Q 022977          226 AKCYARYSEGGDH  238 (289)
Q Consensus       226 ~~C~lRYe~~~f~  238 (289)
                      +-|+.+|+..+-+
T Consensus       123 ~~CN~n~s~~~~~  135 (534)
T KOG3653|consen  123 DFCNANFSHLPPP  135 (534)
T ss_pred             CcccCCccccCCC
Confidence            4788888754333


No 30 
>PF13268 DUF4059:  Protein of unknown function (DUF4059)
Probab=66.99  E-value=8.8  Score=27.61  Aligned_cols=19  Identities=16%  Similarity=-0.113  Sum_probs=10.4

Q ss_pred             HHHHHHHHHHHHhhcCCCC
Q 022977          269 LLVIFLSSIRRLCDGKGKG  287 (289)
Q Consensus       269 ~~~~~~~~~~~~~~~~~~~  287 (289)
                      +++++..|+-+|..|+|+|
T Consensus        20 V~~~~~~wi~~Ra~~~~DK   38 (72)
T PF13268_consen   20 VLLVSGIWILWRALRKKDK   38 (72)
T ss_pred             HHHHHHHHHHHHHHHcCCC
Confidence            3445555655556566655


No 31 
>TIGR01478 STEVOR variant surface antigen, stevor family. This model represents the stevor branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of stevor sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 8 bits.
Probab=65.08  E-value=6.5  Score=35.95  Aligned_cols=15  Identities=13%  Similarity=0.346  Sum_probs=10.3

Q ss_pred             HHHHHHHHHHHHhhh
Q 022977           51 ENSVNSMLTSLVNSA   65 (289)
Q Consensus        51 ~~nl~~ll~~L~~~a   65 (289)
                      +..++++++.+-..|
T Consensus        57 DpEmK~iid~~n~ea   71 (295)
T TIGR01478        57 DPELKEIIDKLNEEA   71 (295)
T ss_pred             cHHHHHHHHHHhHHH
Confidence            467788888777633


No 32 
>PTZ00370 STEVOR; Provisional
Probab=61.83  E-value=7.1  Score=35.77  Aligned_cols=14  Identities=0%  Similarity=0.285  Sum_probs=10.3

Q ss_pred             HHHHHHHHHHHHhh
Q 022977           51 ENSVNSMLTSLVNS   64 (289)
Q Consensus        51 ~~nl~~ll~~L~~~   64 (289)
                      +..++++++.+-..
T Consensus        56 DpemK~i~d~~n~e   69 (296)
T PTZ00370         56 DPELKEIIDKMNEE   69 (296)
T ss_pred             cHHHHHHHHHHhHH
Confidence            46788888888763


No 33 
>PF15099 PIRT:  Phosphoinositide-interacting protein family
Probab=60.09  E-value=4.3  Score=32.56  Aligned_cols=30  Identities=13%  Similarity=0.120  Sum_probs=13.4

Q ss_pred             EEEEehHHHHHHHHH--HHH-HHHHHHHhhcCC
Q 022977          256 TLAILIGMIAGIALL--VIF-LSSIRRLCDGKG  285 (289)
Q Consensus       256 ~~~Ivv~~~~~~~~~--~~~-~~~~~~~~~~~~  285 (289)
                      ++-|+-+++..+.++  ++. ++|.-+++||+|
T Consensus        79 i~~~~G~vlLs~GLmlL~~~alcW~~~~rkK~~  111 (129)
T PF15099_consen   79 IISIFGPVLLSLGLMLLACSALCWKPIIRKKKK  111 (129)
T ss_pred             hhhhehHHHHHHHHHHHHhhhheehhhhHhHHH
Confidence            444555555544433  333 444433333333


No 34 
>PF13908 Shisa:  Wnt and FGF inhibitory regulator
Probab=59.47  E-value=6.9  Score=33.14  Aligned_cols=9  Identities=33%  Similarity=0.807  Sum_probs=4.0

Q ss_pred             EEEehHHHH
Q 022977          257 LAILIGMIA  265 (289)
Q Consensus       257 ~~Ivv~~~~  265 (289)
                      ..|||+|++
T Consensus        78 ~~iivgvi~   86 (179)
T PF13908_consen   78 TGIIVGVIC   86 (179)
T ss_pred             eeeeeehhh
Confidence            344444433


No 35 
>PF02009 Rifin_STEVOR:  Rifin/stevor family;  InterPro: IPR002858 Malaria is still a major cause of mortality in many areas of the world. Plasmodium falciparum causes the most severe human form of the disease and is responsible for most fatalities. Severe cases of malaria can occur when the parasite invades and then proliferates within red blood cell erythrocytes. The parasite produces many variant antigenic proteins, encoded by multigene families, which are present on the surface of the infected erythrocyte and play important roles in virulence. A crucial survival mechanism for the malaria parasite is its ability to evade the immune response by switching these variant surface antigens. The high virulence of P. falciparum relative to other malarial parasites is in large part due to the fact that in this organism many of these surface antigens mediate the binding of infected erythrocytes to the vascular endothelium (cytoadherence) and non-infected erythrocytes (rosetting). This can lead to the accumulation of infected cells in the vasculature of a variety of organs, blocking the blood flow and reducing the oxygen supply. Clinical symptoms of severe infection can include fever, progressive anaemia, multi-organ dysfunction and coma. For more information see []. Several multicopy gene families have been described in Plasmodium falciparum, including the stevor family of subtelomeric open reading frames and the rif interspersed repetitive elements. Both families contain three predicted transmembrane segments. It has been proposed that stevor and rif are members of a larger superfamily that code for variant surface antigens [].
Probab=55.62  E-value=7.2  Score=36.12  Aligned_cols=6  Identities=17%  Similarity=-0.053  Sum_probs=2.5

Q ss_pred             hcCCCC
Q 022977          282 DGKGKG  287 (289)
Q Consensus       282 ~~~~~~  287 (289)
                      ||+|||
T Consensus       285 KKmkKK  290 (299)
T PF02009_consen  285 KKMKKK  290 (299)
T ss_pred             hhhhHH
Confidence            444443


No 36 
>KOG3637 consensus Vitronectin receptor, alpha subunit [Extracellular structures]
Probab=55.47  E-value=13  Score=40.38  Aligned_cols=27  Identities=15%  Similarity=0.380  Sum_probs=19.8

Q ss_pred             ceEEEEehHHHHHHHHHHHHHHHHHHH
Q 022977          254 EKTLAILIGMIAGIALLVIFLSSIRRL  280 (289)
Q Consensus       254 ~~~~~Ivv~~~~~~~~~~~~~~~~~~~  280 (289)
                      -.+++||++++++++||+++.+.+||.
T Consensus       976 vp~wiIi~svl~GLLlL~llv~~LwK~ 1002 (1030)
T KOG3637|consen  976 VPLWIIILSVLGGLLLLALLVLLLWKC 1002 (1030)
T ss_pred             cceeeehHHHHHHHHHHHHHHHHHHhc
Confidence            347888899999888777666555654


No 37 
>PLN03150 hypothetical protein; Provisional
Probab=55.03  E-value=12  Score=38.10  Aligned_cols=26  Identities=19%  Similarity=0.245  Sum_probs=14.0

Q ss_pred             EEEEehHHHHHHHHHHHHHHHHHHHh
Q 022977          256 TLAILIGMIAGIALLVIFLSSIRRLC  281 (289)
Q Consensus       256 ~~~Ivv~~~~~~~~~~~~~~~~~~~~  281 (289)
                      ++.|++++++++++++++..++||++
T Consensus       546 ~i~~~~~~~~~~l~~~~~~~~~~~~r  571 (623)
T PLN03150        546 KIGIAFGVSVAFLFLVICAMCWWKRR  571 (623)
T ss_pred             EEEEEhHHHHHHHHHHHHHhhheeeh
Confidence            56667777665544444444444433


No 38 
>PF07297 DPM2:  Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2);  InterPro: IPR009914 This family consists of several eukaryotic dolichol phosphate-mannose biosynthesis regulatory (DPM2) proteins. Biosynthesis of glycosylphosphatidylinositol and N-glycan precursor is dependent upon a mannosyl donor, dolichol phosphate-mannose (DPM). DPM2, an 84 amino acid membrane protein expressed in the endoplasmic reticulum (ER), makes a complex with DPM1 that is essential for the ER localisation and stable expression of DPM1. Moreover, DPM2 enhances binding of dolichol phosphate, a substrate of DPM synthase. Biosynthesis of DPM in mammalian cells is regulated by DPM2 [].; GO: 0009059 macromolecule biosynthetic process, 0030176 integral to endoplasmic reticulum membrane
Probab=51.35  E-value=14  Score=27.15  Aligned_cols=15  Identities=20%  Similarity=0.211  Sum_probs=10.0

Q ss_pred             EEEEehHHHHHHHHH
Q 022977          256 TLAILIGMIAGIALL  270 (289)
Q Consensus       256 ~~~Ivv~~~~~~~~~  270 (289)
                      -.||.+|++..++.+
T Consensus        45 ~yAi~lP~~lll~~~   59 (78)
T PF07297_consen   45 EYAIILPIFLLLLGL   59 (78)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            467888887665544


No 39 
>PF12768 Rax2:  Cortical protein marker for cell polarity
Probab=51.23  E-value=27  Score=32.04  Aligned_cols=19  Identities=16%  Similarity=0.242  Sum_probs=10.2

Q ss_pred             cceEEEEehHHHHHHHHHH
Q 022977          253 IEKTLAILIGMIAGIALLV  271 (289)
Q Consensus       253 ~~~~~~Ivv~~~~~~~~~~  271 (289)
                      .+.+|.|-+.+++++++++
T Consensus       226 ~G~VVlIslAiALG~v~ll  244 (281)
T PF12768_consen  226 RGFVVLISLAIALGTVFLL  244 (281)
T ss_pred             ceEEEEEehHHHHHHHHHH
Confidence            3445555566666655444


No 40 
>PF06697 DUF1191:  Protein of unknown function (DUF1191);  InterPro: IPR010605 This family contains hypothetical plant proteins of unknown function.
Probab=50.38  E-value=9  Score=35.03  Aligned_cols=13  Identities=23%  Similarity=0.665  Sum_probs=6.0

Q ss_pred             EEEEehHHHHHHH
Q 022977          256 TLAILIGMIAGIA  268 (289)
Q Consensus       256 ~~~Ivv~~~~~~~  268 (289)
                      .+.||++++++++
T Consensus       212 ~W~iv~g~~~G~~  224 (278)
T PF06697_consen  212 WWKIVVGVVGGVV  224 (278)
T ss_pred             eEEEEEEehHHHH
Confidence            4445555444433


No 41 
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=48.83  E-value=5.7  Score=38.78  Aligned_cols=14  Identities=21%  Similarity=0.351  Sum_probs=9.2

Q ss_pred             EEEEcCCCCChhhH
Q 022977          187 GVAQCVGDLSASEC  200 (289)
Q Consensus       187 glaQC~~DLs~~~C  200 (289)
                      -...|.++-.+.+|
T Consensus       237 ~y~~C~~~~~~~~C  250 (439)
T PF02480_consen  237 RYANCSPSGWPRRC  250 (439)
T ss_dssp             EEEEEBTTC-TTTT
T ss_pred             hhcCCCCCCCcCCC
Confidence            35679888766666


No 42 
>PRK01844 hypothetical protein; Provisional
Probab=47.20  E-value=11  Score=27.32  Aligned_cols=23  Identities=26%  Similarity=0.350  Sum_probs=10.5

Q ss_pred             EehHHHHHHHHHHHHHHHHHHHh
Q 022977          259 ILIGMIAGIALLVIFLSSIRRLC  281 (289)
Q Consensus       259 Ivv~~~~~~~~~~~~~~~~~~~~  281 (289)
                      |++++++.++-++.++++-||..
T Consensus         7 I~l~I~~li~G~~~Gff~ark~~   29 (72)
T PRK01844          7 ILVGVVALVAGVALGFFIARKYM   29 (72)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            44555443333344444445444


No 43 
>PF12877 DUF3827:  Domain of unknown function (DUF3827);  InterPro: IPR024606 The function of the proteins in this entry is not currently known, but one of the human proteins (Q9HCM3 from SWISSPROT) has been implicated in pilocytic astrocytomas [, , ]. In the majority of cases of pilocytic astrocytomas a tandem duplication produces an in-frame fusion of the gene encoding this protein and the BRAF oncogene. The resulting fusion protein has constitutive BRAF kinase activity and is capable of transforming cells. 
Probab=45.25  E-value=21  Score=36.29  Aligned_cols=22  Identities=18%  Similarity=-0.115  Sum_probs=13.4

Q ss_pred             EEEEEcCCCCChhhHHHHHHHH
Q 022977          186 TGVAQCVGDLSASECQDCLSDA  207 (289)
Q Consensus       186 YglaQC~~DLs~~~C~~CL~~a  207 (289)
                      |...+=-.-|.+.++..=|+..
T Consensus       212 yV~~~~G~pl~a~~AA~~Ln~l  233 (684)
T PF12877_consen  212 YVEGQNGKPLPAVTAAKDLNLL  233 (684)
T ss_pred             EEEcCCCcCCcHHHHHHHHhcc
Confidence            3333666677777777666544


No 44 
>PF05454 DAG1:  Dystroglycan (Dystrophin-associated glycoprotein 1);  InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5.5 kb transcript in Homo sapiens. The protein product is cleaved into two non-covalently associated subunits, [alpha] (N-terminal) and [beta] (C-terminal). In skeletal muscle the dystroglycan complex works as a transmembrane linkage between the extracellular matrix and the cytoskeleton [alpha]-dystroglycan is extracellular and binds to merosin ([alpha]-2 laminin) in the basement membrane, while [beta]-dystroglycan is a transmembrane protein and binds to dystrophin, which is a large rod-like cytoskeletal protein, absent in Duchenne muscular dystrophy patients. Dystrophin binds to intracellular actin cables. In this way, the dystroglycan complex, which links the extracellular matrix to the intracellular actin cables, is thought to provide structural integrity in muscle tissues. The dystroglycan complex is also known to serve as an agrin receptor in muscle, where it may regulate agrin-induced acetylcholine receptor clustering at the neuromuscular junction. There is also evidence which suggests the function of dystroglycan as a part of the signal transduction pathway because it is shown that Grb2, a mediator of the Ras-related signal pathway, can interact with the cytoplasmic domain of dystroglycan. In general, aberrant expression of dystrophin-associated protein complex underlies the pathogenesis of Duchenne muscular dystrophy, Becker muscular dystrophy and severe childhood autosomal recessive muscular dystrophy. Interestingly, no genetic disease has been described for either [alpha]- or [beta]-dystroglycan. Dystroglycan is widely distributed in non-muscle tissues as well as in muscle tissues. During epithelial morphogenesis of kidney, the dystroglycan complex is shown to act as a receptor for the basement membrane. Dystroglycan expression in Mus musculus brain and neural retina has also been reported. However, the physiological role of dystroglycan in non-muscle tissues has remained unclear [].; PDB: 1EG4_P.
Probab=44.33  E-value=7.4  Score=35.85  Aligned_cols=11  Identities=18%  Similarity=0.150  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHH
Q 022977          267 IALLVIFLSSI  277 (289)
Q Consensus       267 ~~~~~~~~~~~  277 (289)
                      ++.+|++++|.
T Consensus       161 IA~iIa~icyr  171 (290)
T PF05454_consen  161 IAGIIACICYR  171 (290)
T ss_dssp             -----------
T ss_pred             HHHHHHHHhhh
Confidence            33334444443


No 45 
>KOG1226 consensus Integrin beta subunit (N-terminal portion of extracellular region) [Signal transduction mechanisms; Extracellular structures]
Probab=44.04  E-value=29  Score=36.00  Aligned_cols=29  Identities=38%  Similarity=0.529  Sum_probs=22.8

Q ss_pred             cceEEEEehHHHHHHHHHHHHHHHHHHHh
Q 022977          253 IEKTLAILIGMIAGIALLVIFLSSIRRLC  281 (289)
Q Consensus       253 ~~~~~~Ivv~~~~~~~~~~~~~~~~~~~~  281 (289)
                      ...+++|+++++++++++.+++..+||..
T Consensus       710 ~~~~~~i~lgvv~~ivligl~llliwkll  738 (783)
T KOG1226|consen  710 GPNILAIVLGVVAGIVLIGLALLLIWKLL  738 (783)
T ss_pred             CCcEeeehHHHHHHHHHHHHHHHHHHHHh
Confidence            34589999999998887777777778764


No 46 
>PF05808 Podoplanin:  Podoplanin;  InterPro: IPR008783 This family consists of several mammalian podoplanin-like proteins which are thought to control specifically the unique shape of podocytes [].; GO: 0016021 integral to membrane; PDB: 3IET_X.
Probab=43.84  E-value=7.6  Score=32.52  Aligned_cols=27  Identities=15%  Similarity=0.404  Sum_probs=0.0

Q ss_pred             cceEEEEehHHHHHHHHHHH-HHHHHHH
Q 022977          253 IEKTLAILIGMIAGIALLVI-FLSSIRR  279 (289)
Q Consensus       253 ~~~~~~Ivv~~~~~~~~~~~-~~~~~~~  279 (289)
                      ...++-||||+++++.++.- +++++||
T Consensus       128 T~tLVGIIVGVLlaIG~igGIIivvvRK  155 (162)
T PF05808_consen  128 TVTLVGIIVGVLLAIGFIGGIIIVVVRK  155 (162)
T ss_dssp             ----------------------------
T ss_pred             eeeeeeehhhHHHHHHHHhheeeEEeeh
Confidence            34468888998888877663 3334444


No 47 
>PHA02650 hypothetical protein; Provisional
Probab=43.00  E-value=23  Score=25.98  Aligned_cols=19  Identities=16%  Similarity=0.088  Sum_probs=9.6

Q ss_pred             HHHHHHHHHHhhcCCCCCC
Q 022977          271 VIFLSSIRRLCDGKGKGGK  289 (289)
Q Consensus       271 ~~~~~~~~~~~~~~~~~~~  289 (289)
                      ++.++++.|..+|--++.|
T Consensus        63 ~l~~flYLK~~~r~~~~~~   81 (81)
T PHA02650         63 ALFSFFVFKGYTRNLNGRK   81 (81)
T ss_pred             HHHHHHHHHHhccccCCCC
Confidence            3334445566666555543


No 48 
>PF14914 LRRC37AB_C:  LRRC37A/B like protein 1 C-terminal domain
Probab=42.88  E-value=16  Score=30.13  Aligned_cols=25  Identities=24%  Similarity=0.329  Sum_probs=12.2

Q ss_pred             eEEEEehHHHHHHHHHHHHHHHHHH
Q 022977          255 KTLAILIGMIAGIALLVIFLSSIRR  279 (289)
Q Consensus       255 ~~~~Ivv~~~~~~~~~~~~~~~~~~  279 (289)
                      .+++|-|.+++-++++++|+..++.
T Consensus       121 lilaisvtvv~~iliii~CLiei~s  145 (154)
T PF14914_consen  121 LILAISVTVVVMILIIIFCLIEICS  145 (154)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            3555555554434444455554443


No 49 
>TIGR02976 phageshock_pspB phage shock protein B. This model describes the PspB protein of the psp (phage shock protein) operon, as found in Escherichia coli and many related species. Expression of a phage protein called secretin protein IV, and a number of other stresses including ethanol, heat shock, and defects in protein secretion trigger sigma-54-dependent expression of the phage shock regulon. PspB is both a regulator and an effector protein of the phage shock response.
Probab=42.67  E-value=30  Score=25.26  Aligned_cols=10  Identities=20%  Similarity=0.238  Sum_probs=4.9

Q ss_pred             EehHHHHHHH
Q 022977          259 ILIGMIAGIA  268 (289)
Q Consensus       259 Ivv~~~~~~~  268 (289)
                      +++|+++.++
T Consensus         6 l~~Pliif~i   15 (75)
T TIGR02976         6 LAIPLIIFVI   15 (75)
T ss_pred             HHHHHHHHHH
Confidence            4556554433


No 50 
>PF15176 LRR19-TM:  Leucine-rich repeat family 19 TM domain
Probab=42.26  E-value=25  Score=27.14  Aligned_cols=17  Identities=12%  Similarity=0.391  Sum_probs=12.1

Q ss_pred             ceEEEEehHHHHHHHHH
Q 022977          254 EKTLAILIGMIAGIALL  270 (289)
Q Consensus       254 ~~~~~Ivv~~~~~~~~~  270 (289)
                      ++.++.+||||++++++
T Consensus        14 g~sW~~LVGVv~~al~~   30 (102)
T PF15176_consen   14 GRSWPFLVGVVVTALVT   30 (102)
T ss_pred             CcccHhHHHHHHHHHHH
Confidence            66788888887765543


No 51 
>PF04478 Mid2:  Mid2 like cell wall stress sensor;  InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region. The remainder of the protein sequence is serine-rich and of low complexity, and is therefore impossible to align accurately. Mid2 is thought to act as a mechanosensor of cell wall stress. The C-terminal cytoplasmic region of Mid2 is known to interact with Rom2, a guanine nucleotide exchange factor (GEF) for Rho1, which is part of the cell wall integrity signalling pathway [].
Probab=42.06  E-value=7.4  Score=32.32  Aligned_cols=28  Identities=18%  Similarity=0.338  Sum_probs=15.4

Q ss_pred             ceEEEEehHHHHHHHHHH-HHHHHHHHHh
Q 022977          254 EKTLAILIGMIAGIALLV-IFLSSIRRLC  281 (289)
Q Consensus       254 ~~~~~Ivv~~~~~~~~~~-~~~~~~~~~~  281 (289)
                      .+.-.||||+++++.+.+ +++..+....
T Consensus        45 ~knknIVIGvVVGVGg~ill~il~lvf~~   73 (154)
T PF04478_consen   45 SKNKNIVIGVVVGVGGPILLGILALVFIF   73 (154)
T ss_pred             cCCccEEEEEEecccHHHHHHHHHhheeE
Confidence            334567777777764443 4445555543


No 52 
>PF06697 DUF1191:  Protein of unknown function (DUF1191);  InterPro: IPR010605 This family contains hypothetical plant proteins of unknown function.
Probab=40.43  E-value=36  Score=31.15  Aligned_cols=22  Identities=14%  Similarity=-0.008  Sum_probs=13.1

Q ss_pred             CCCCCcceE-EEEehHHHHHHHH
Q 022977          248 DNDEEIEKT-LAILIGMIAGIAL  269 (289)
Q Consensus       248 ~~~~~~~~~-~~Ivv~~~~~~~~  269 (289)
                      +++.+.+++ +.+++|+++.+++
T Consensus       207 ~~~~~~W~iv~g~~~G~~~L~ll  229 (278)
T PF06697_consen  207 RKRSWWWKIVVGVVGGVVLLGLL  229 (278)
T ss_pred             CCcceeEEEEEEehHHHHHHHHH
Confidence            344567885 5567777654444


No 53 
>PF09835 DUF2062:  Uncharacterized protein conserved in bacteria (DUF2062);  InterPro: IPR018639  This domain, found in various prokaryotic proteins, has no known function. It is found at the C-terminal of family 2 glycosyltransferase proteins, in addition to proteins of unknown function.
Probab=39.99  E-value=20  Score=29.42  Aligned_cols=11  Identities=18%  Similarity=0.356  Sum_probs=4.5

Q ss_pred             HHHHhhcCCCC
Q 022977          277 IRRLCDGKGKG  287 (289)
Q Consensus       277 ~~~~~~~~~~~  287 (289)
                      +++.+||++||
T Consensus       143 ~~~~r~~r~~~  153 (154)
T PF09835_consen  143 VRKYRKRRRKR  153 (154)
T ss_pred             HHHHHHHHHhC
Confidence            44444444433


No 54 
>PF13908 Shisa:  Wnt and FGF inhibitory regulator
Probab=39.98  E-value=17  Score=30.67  Aligned_cols=20  Identities=25%  Similarity=0.398  Sum_probs=11.6

Q ss_pred             CcceEEEEehHHHHHHHHHH
Q 022977          252 EIEKTLAILIGMIAGIALLV  271 (289)
Q Consensus       252 ~~~~~~~Ivv~~~~~~~~~~  271 (289)
                      ....++.||++|++.+++++
T Consensus        77 ~~~iivgvi~~Vi~Iv~~Iv   96 (179)
T PF13908_consen   77 ITGIIVGVICGVIAIVVLIV   96 (179)
T ss_pred             eeeeeeehhhHHHHHHHhHh
Confidence            44567777777665444333


No 55 
>PF06667 PspB:  Phage shock protein B;  InterPro: IPR009554 This family consists of several bacterial phage shock protein B (PspB) sequences. The phage shock protein (psp) operon is induced in response to heat, ethanol, osmotic shock and infection by filamentous bacteriophages []. Expression of the operon requires the alternative sigma factor sigma54 and the transcriptional activator PspF. In addition, PspA plays a negative regulatory role, and the integral-membrane proteins PspB and PspC play a positive one [].; GO: 0006355 regulation of transcription, DNA-dependent, 0009271 phage shock
Probab=38.82  E-value=40  Score=24.61  Aligned_cols=10  Identities=10%  Similarity=0.325  Sum_probs=4.3

Q ss_pred             EehHHHHHHH
Q 022977          259 ILIGMIAGIA  268 (289)
Q Consensus       259 Ivv~~~~~~~  268 (289)
                      |++|+++.++
T Consensus         6 l~~plivf~i   15 (75)
T PF06667_consen    6 LFVPLIVFMI   15 (75)
T ss_pred             HHHHHHHHHH
Confidence            3445444333


No 56 
>PRK00523 hypothetical protein; Provisional
Probab=38.14  E-value=18  Score=26.17  Aligned_cols=24  Identities=17%  Similarity=0.051  Sum_probs=9.7

Q ss_pred             EEehHHHHHHHHHHHHHHHHHHHh
Q 022977          258 AILIGMIAGIALLVIFLSSIRRLC  281 (289)
Q Consensus       258 ~Ivv~~~~~~~~~~~~~~~~~~~~  281 (289)
                      +|++.+++.++-++.++++-||..
T Consensus         7 ~I~l~i~~li~G~~~Gffiark~~   30 (72)
T PRK00523          7 ALGLGIPLLIVGGIIGYFVSKKMF   30 (72)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            344444433333334444444443


No 57 
>PF13955 Fst_toxin:  Toxin Fst, type I toxin-antitoxin system; PDB: 2KV5_A.
Probab=38.12  E-value=20  Score=19.53  Aligned_cols=13  Identities=23%  Similarity=0.626  Sum_probs=8.0

Q ss_pred             EehHHHHHHHHHH
Q 022977          259 ILIGMIAGIALLV  271 (289)
Q Consensus       259 Ivv~~~~~~~~~~  271 (289)
                      ||.|+++++++.+
T Consensus         4 iIaPi~VGvvl~l   16 (21)
T PF13955_consen    4 IIAPIVVGVVLTL   16 (21)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             ehhhHHHHHHHHH
Confidence            5667777666443


No 58 
>PTZ00045 apical membrane antigen 1; Provisional
Probab=37.01  E-value=37  Score=34.20  Aligned_cols=15  Identities=20%  Similarity=0.235  Sum_probs=9.8

Q ss_pred             hhHHHHHHHHHHHHh
Q 022977           94 ADCGRCVAHAVSQLG  108 (289)
Q Consensus        94 ~~C~~Cl~~a~~~~~  108 (289)
                      .|+..|-..|...++
T Consensus       207 ~dla~Ca~~a~~~vp  221 (595)
T PTZ00045        207 NDLALCAEYASNFVP  221 (595)
T ss_pred             hhHHHHHHHHHhcCc
Confidence            566677777666655


No 59 
>PF00558 Vpu:  Vpu protein;  InterPro: IPR008187 The Human immunodeficiency virus 1 (HIV-1) Vpu protein acts in the degradation of CD4 in the endoplasmic reticulum and in the enhancement of virion release from the plasma membrane of infected cells [].; GO: 0019076 release of virus from host; PDB: 2JPX_A 1PI8_A 2GOH_A 2GOF_A 1PI7_A 1PJE_A 1VPU_A 2K7Y_A.
Probab=36.76  E-value=8.5  Score=28.51  Aligned_cols=6  Identities=33%  Similarity=0.434  Sum_probs=2.0

Q ss_pred             hHHHHH
Q 022977          261 IGMIAG  266 (289)
Q Consensus       261 v~~~~~  266 (289)
                      +++++.
T Consensus         7 ~~iial   12 (81)
T PF00558_consen    7 LAIIAL   12 (81)
T ss_dssp             -HHHHH
T ss_pred             HHHHHH
Confidence            444333


No 60 
>PF12191 stn_TNFRSF12A:  Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain;  InterPro: IPR022316 The tumour necrosis factor (TNF) receptor (TNFR) superfamily comprises more than 20 type-I transmembrane proteins. Family members are defined based on similarity in their extracellular domain - a region that contains many cysteine residues arranged in a specific repetitive pattern []. The cysteines allow formation of an extended rod-like structure, responsible for ligand binding []. Upon receptor activation, different intracellular signalling complexes are assembled for different members of the TNFR superfamily, depending on their intracellular domains and sequences []. Activation of TNFRs can therefore induce a range of disparate effects, including cell proliferation, differentiation, survival, or apoptotic cell death, depending upon the receptor involved []. TNFRs are widely distributed and play important roles in many crucial biological processes, such as lymphoid and neuronal development, innate and adaptive immunity, and maintenance of cellular homeostasis []. Drugs that manipulate their signalling have potential roles in the prevention and treatment of many diseases, such as viral infections, coronary heart disease, transplant rejection, and immune disease []. TNF receptor 12 (also known as TWEAK receptor, and fibroblast growth factor-inducible-14 (Fn14)) has been implicated in endothelial cell growth and migration []. The receptor may also play a role in cell-matrix interactions [].; PDB: 2KN0_A 2RPJ_A 2KMZ_A 2EQP_A.
Probab=36.15  E-value=8.4  Score=30.90  Aligned_cols=7  Identities=29%  Similarity=0.658  Sum_probs=0.0

Q ss_pred             HHHhhcC
Q 022977          278 RRLCDGK  284 (289)
Q Consensus       278 ~~~~~~~  284 (289)
                      ||+.+|+
T Consensus       101 ~rrcrrr  107 (129)
T PF12191_consen  101 WRRCRRR  107 (129)
T ss_dssp             -------
T ss_pred             Hhhhhcc
Confidence            3333333


No 61 
>PF01708 Gemini_mov:  Geminivirus putative movement protein ;  InterPro: IPR002621 This family consists of putative movement proteins from Maize streak virus and Wheat dwarf virus [].; GO: 0046740 spread of virus in host, cell to cell, 0016021 integral to membrane
Probab=35.87  E-value=1.5e+02  Score=22.44  Aligned_cols=25  Identities=8%  Similarity=0.150  Sum_probs=12.8

Q ss_pred             cceEEEEehHHHHHHHHHHHHHHHH
Q 022977          253 IEKTLAILIGMIAGIALLVIFLSSI  277 (289)
Q Consensus       253 ~~~~~~Ivv~~~~~~~~~~~~~~~~  277 (289)
                      -++++.|+|.+++++.++-+.+.|+
T Consensus        34 ws~vv~v~i~~lvaVg~~YL~y~~f   58 (91)
T PF01708_consen   34 WSRVVEVAIFTLVAVGCLYLAYTWF   58 (91)
T ss_pred             ceeEeeeeehHHHHHHHHHHHHHHH
Confidence            4555556555655555444444443


No 62 
>PF07213 DAP10:  DAP10 membrane protein;  InterPro: IPR009861 This family consists of several mammalian DAP10 membrane proteins. In activated mouse natural killer (NK) cells, the NKG2D receptor associates with two intracellular adaptors, DAP10 and DAP12, which trigger phosphatidyl inositol 3 kinase (PI3K) and Syk family protein tyrosine kinases, respectively. It has been suggested that the DAP10-PI3K pathway is sufficient to initiate NKG2D-mediated killing of target cells [].
Probab=35.52  E-value=29  Score=25.58  Aligned_cols=12  Identities=8%  Similarity=-0.075  Sum_probs=5.1

Q ss_pred             HHHHhhcCCCCC
Q 022977          277 IRRLCDGKGKGG  288 (289)
Q Consensus       277 ~~~~~~~~~~~~  288 (289)
                      -|.++|++++.+
T Consensus        58 ar~r~r~~~~~~   69 (79)
T PF07213_consen   58 ARPRRRPTQEDD   69 (79)
T ss_pred             cccccCCcccCC
Confidence            334444444444


No 63 
>PF05568 ASFV_J13L:  African swine fever virus J13L protein;  InterPro: IPR008385 This family consists of several African swine fever virus (ASFV) j13L proteins [, , ].
Probab=35.41  E-value=35  Score=28.16  Aligned_cols=14  Identities=14%  Similarity=0.415  Sum_probs=6.0

Q ss_pred             EEehHHHHHHHHHH
Q 022977          258 AILIGMIAGIALLV  271 (289)
Q Consensus       258 ~Ivv~~~~~~~~~~  271 (289)
                      .-+.-|++++++++
T Consensus        29 thm~tILiaIvVli   42 (189)
T PF05568_consen   29 THMYTILIAIVVLI   42 (189)
T ss_pred             HHHHHHHHHHHHHH
Confidence            33444444444443


No 64 
>PTZ00087 thrombosponding-related protein; Provisional
Probab=35.34  E-value=46  Score=30.38  Aligned_cols=23  Identities=26%  Similarity=0.326  Sum_probs=16.0

Q ss_pred             CcceEEEEehHHHHHHHHHHHHH
Q 022977          252 EIEKTLAILIGMIAGIALLVIFL  274 (289)
Q Consensus       252 ~~~~~~~Ivv~~~~~~~~~~~~~  274 (289)
                      ++-+++.|++||++.+.++++.+
T Consensus       294 st~~i~~i~~piv~vi~v~~ily  316 (340)
T PTZ00087        294 STFKILIILLPIVLIICVMGILY  316 (340)
T ss_pred             CcceEeeeehhHHHHHHHHHHHH
Confidence            44568888999987766555544


No 65 
>PF03302 VSP:  Giardia variant-specific surface protein;  InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein).
Probab=34.76  E-value=31  Score=33.25  Aligned_cols=15  Identities=7%  Similarity=0.182  Sum_probs=7.6

Q ss_pred             ceEEEEehHHHHHHH
Q 022977          254 EKTLAILIGMIAGIA  268 (289)
Q Consensus       254 ~~~~~Ivv~~~~~~~  268 (289)
                      +-|.-|.|.+|++|.
T Consensus       367 gaIaGIsvavvvvVg  381 (397)
T PF03302_consen  367 GAIAGISVAVVVVVG  381 (397)
T ss_pred             cceeeeeehhHHHHH
Confidence            335556665544433


No 66 
>TIGR01477 RIFIN variant surface antigen, rifin family. This model represents the rifin branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of rifin sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 20 bits.
Probab=34.41  E-value=21  Score=33.78  Aligned_cols=26  Identities=23%  Similarity=0.330  Sum_probs=12.1

Q ss_pred             CChhhHHHHHHHHHHHHhhhCCCCce
Q 022977           91 LSTADCGRCVAHAVSQLGTLCLDSCG  116 (289)
Q Consensus        91 ls~~~C~~Cl~~a~~~~~~~C~~~~~  116 (289)
                      ++.--|.-=|++=+..-==.|...-|
T Consensus       126 IPTCvCEKSlADKvEK~CLkCg~~LG  151 (353)
T TIGR01477       126 IPTCVCEKSLADKVEKGCLRCGCGLG  151 (353)
T ss_pred             CccccccchHHHHHHHhHHhcCCccC
Confidence            34444555555544433334555555


No 67 
>PTZ00046 rifin; Provisional
Probab=34.19  E-value=21  Score=33.81  Aligned_cols=26  Identities=23%  Similarity=0.330  Sum_probs=11.0

Q ss_pred             CChhhHHHHHHHHHHHHhhhCCCCce
Q 022977           91 LSTADCGRCVAHAVSQLGTLCLDSCG  116 (289)
Q Consensus        91 ls~~~C~~Cl~~a~~~~~~~C~~~~~  116 (289)
                      ++.--|.-=|++=+..-==.|...-|
T Consensus       123 IPTCVCEKSlADKvEK~CLkCG~~LG  148 (358)
T PTZ00046        123 IPTCVCEKSLADKVEKGCLRCGCGLG  148 (358)
T ss_pred             CccccccchHHHHHHHHHHhcCCccc
Confidence            33334555444444333223554433


No 68 
>COG3197 FixS Uncharacterized protein, possibly involved in nitrogen fixation [Inorganic ion transport and metabolism]
Probab=33.67  E-value=61  Score=22.38  Aligned_cols=16  Identities=25%  Similarity=0.144  Sum_probs=9.7

Q ss_pred             EEEEehHHHHHHHHHH
Q 022977          256 TLAILIGMIAGIALLV  271 (289)
Q Consensus       256 ~~~Ivv~~~~~~~~~~  271 (289)
                      ++.|++|+.+.+++++
T Consensus         3 ~l~~Lipvsi~l~~v~   18 (58)
T COG3197           3 ILYILIPVSILLGAVG   18 (58)
T ss_pred             eeeeHHHHHHHHHHHH
Confidence            5677888765444333


No 69 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=33.57  E-value=29  Score=27.79  Aligned_cols=29  Identities=24%  Similarity=0.197  Sum_probs=14.5

Q ss_pred             ehHHHHHHHHHH-HHHHHHHHHhhcCCCCC
Q 022977          260 LIGMIAGIALLV-IFLSSIRRLCDGKGKGG  288 (289)
Q Consensus       260 vv~~~~~~~~~~-~~~~~~~~~~~~~~~~~  288 (289)
                      |++|+++++.-+ ..+.++....+|.+||-
T Consensus        66 i~~Ii~gv~aGvIg~Illi~y~irR~~Kk~   95 (122)
T PF01102_consen   66 IIGIIFGVMAGVIGIILLISYCIRRLRKKS   95 (122)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHS---
T ss_pred             eeehhHHHHHHHHHHHHHHHHHHHHHhccC
Confidence            445555544443 44456666667777763


No 70 
>PF06365 CD34_antigen:  CD34/Podocalyxin family;  InterPro: IPR013836 This family consists of several mammalian CD34 antigen proteins. The CD34 antigen is a human leukocyte membrane protein expressed specifically by lymphohematopoietic progenitor cells. CD34 is a phosphoprotein. Activation of protein kinase C (PKC) has been found to enhance CD34 phosphorylation [, ]. This family contains several eukaryotic podocalyxin proteins. Podocalyxin is a major membrane protein of the glomerular epithelium and is thought to be involved in maintenance of the architecture of the foot processes and filtration slits characteristic of this unique epithelium by virtue of its high negative charge. Podocalyxin functions as an anti-adhesin that maintains an open filtration pathway between neighbouring foot processes in the glomerular epithelium by charge repulsion [].
Probab=33.53  E-value=69  Score=27.94  Aligned_cols=6  Identities=0%  Similarity=-0.180  Sum_probs=2.9

Q ss_pred             HHHHHh
Q 022977          276 SIRRLC  281 (289)
Q Consensus       276 ~~~~~~  281 (289)
                      ++++|+
T Consensus       123 ~~~~Rr  128 (202)
T PF06365_consen  123 CCHQRR  128 (202)
T ss_pred             Hhhhhc
Confidence            455544


No 71 
>PF02430 AMA-1:  Apical membrane antigen 1;  InterPro: IPR003298 A novel antigen of Plasmodium falciparum has been cloned that contains a hydrophobic domain typical of an integral membrane protein. The antigen is designated apical membrane antigen 1 (AMA-1) by virtue of appearing to be located in the apical complex []. AMA-1 appears to be transported to the merozoite surface close to the time of schizont rupture. The 66kDa merozoite surface antigen (PK66) of Plasmodium knowlesi, a simian malaria, possesses vaccine-related properties believed to originate from a receptor-like role in parasite invasion of erythrocytes []. The sequence of PK66 is conserved throughout plasmodium, and shows high similarity to P. falciparum AMA-1. Following schizont rupture, the distribution of PK66 changes in a coordinate manner associated with merozoite invasion. Prior to rupture, the protein is concentrated at the apical end, following which it distributes itself entirely across the surface of the free merozoite. Immunofluorescence studies suggest that, during invasion, PK66 is excluded from the erythrocyte at, and behind, the invasion interface []. ; GO: 0009405 pathogenesis, 0016020 membrane; PDB: 2Y8R_D 2X2Z_A 2Y8T_A 2Y8S_D 1HN6_A 2Z8V_B 2Z8W_A 1Z40_E 2Q8B_A 2Q8A_A ....
Probab=32.87  E-value=14  Score=35.88  Aligned_cols=23  Identities=22%  Similarity=0.417  Sum_probs=0.0

Q ss_pred             EEEehHHHHHHHHHHHHHHHHHH
Q 022977          257 LAILIGMIAGIALLVIFLSSIRR  279 (289)
Q Consensus       257 ~~Ivv~~~~~~~~~~~~~~~~~~  279 (289)
                      ++|++.+.++++|+.+.+.|++|
T Consensus       430 ~~~~~~~~~~~~~~~l~~~~~~k  452 (471)
T PF02430_consen  430 IVIIISIATGAVLLALAIYWYYK  452 (471)
T ss_dssp             -----------------------
T ss_pred             eehhhHHHHHHHHHHHHHHHHHh
Confidence            44444444444444444444444


No 72 
>PF08374 Protocadherin:  Protocadherin;  InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains. They are expressed in a variety of organisms and are found in high concentrations in the brain where they seem to be localised mainly at cell-cell contact sites. Their expression seems to be developmentally regulated []. 
Probab=32.85  E-value=28  Score=30.61  Aligned_cols=26  Identities=19%  Similarity=0.410  Sum_probs=16.8

Q ss_pred             EEEEehHHHHHHHHHHHHHHHHHHHh
Q 022977          256 TLAILIGMIAGIALLVIFLSSIRRLC  281 (289)
Q Consensus       256 ~~~Ivv~~~~~~~~~~~~~~~~~~~~  281 (289)
                      -+.|+++||++++.+|+.++...-.+
T Consensus        36 ~~~I~iaiVAG~~tVILVI~i~v~vR   61 (221)
T PF08374_consen   36 YVKIMIAIVAGIMTVILVIFIVVLVR   61 (221)
T ss_pred             ceeeeeeeecchhhhHHHHHHHHHHH
Confidence            46777777777776666665554444


No 73 
>PTZ00382 Variant-specific surface protein (VSP); Provisional
Probab=32.24  E-value=22  Score=27.13  Aligned_cols=6  Identities=33%  Similarity=1.459  Sum_probs=3.4

Q ss_pred             hhHHHH
Q 022977          198 SECQDC  203 (289)
Q Consensus       198 ~~C~~C  203 (289)
                      +.|..|
T Consensus        28 ~~C~~C   33 (96)
T PTZ00382         28 GNCKSC   33 (96)
T ss_pred             CCCcCC
Confidence            356666


No 74 
>COG1862 YajC Preprotein translocase subunit YajC [Intracellular trafficking and secretion]
Probab=32.04  E-value=13  Score=28.60  Aligned_cols=10  Identities=40%  Similarity=0.341  Sum_probs=4.2

Q ss_pred             HHHHHHHHHH
Q 022977          271 VIFLSSIRRL  280 (289)
Q Consensus       271 ~~~~~~~~~~  280 (289)
                      ++++++++|.
T Consensus        20 ~ifyFli~RP   29 (97)
T COG1862          20 AIFYFLIIRP   29 (97)
T ss_pred             HHHHHhhcCH
Confidence            3444434444


No 75 
>PRK15471 chain length determinant protein WzzB; Provisional
Probab=31.78  E-value=44  Score=31.34  Aligned_cols=23  Identities=9%  Similarity=0.199  Sum_probs=12.0

Q ss_pred             CCCCCCCcceEEEEehHHHHHHH
Q 022977          246 DDDNDEEIEKTLAILIGMIAGIA  268 (289)
Q Consensus       246 ~~~~~~~~~~~~~Ivv~~~~~~~  268 (289)
                      .|-+.++.++.+.+|++++++++
T Consensus       285 ~Pv~~d~Pkr~lIlil~~~lG~~  307 (325)
T PRK15471        285 LPVRRDSPKKAITLVLAVLLGGM  307 (325)
T ss_pred             CCCCCCCCcchhHHHHHHHHHHH
Confidence            34444555565555555555443


No 76 
>COG3763 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=31.59  E-value=20  Score=25.71  Aligned_cols=11  Identities=9%  Similarity=-0.230  Sum_probs=4.5

Q ss_pred             HHHHHHHHHhh
Q 022977          272 IFLSSIRRLCD  282 (289)
Q Consensus       272 ~~~~~~~~~~~  282 (289)
                      .++++.||..+
T Consensus        20 ~G~fiark~~~   30 (71)
T COG3763          20 GGFFIARKQMK   30 (71)
T ss_pred             HHHHHHHHHHH
Confidence            34444444443


No 77 
>PRK01821 hypothetical protein; Provisional
Probab=31.30  E-value=31  Score=28.00  Aligned_cols=14  Identities=21%  Similarity=0.185  Sum_probs=6.2

Q ss_pred             HHHHHhhcCCCCCC
Q 022977          276 SIRRLCDGKGKGGK  289 (289)
Q Consensus       276 ~~~~~~~~~~~~~~  289 (289)
                      ++.|+++.-|||+|
T Consensus       117 ~l~~~~~~~~~~~~  130 (133)
T PRK01821        117 YVHGERKVIGQKGK  130 (133)
T ss_pred             HHHhhhhccCCCCc
Confidence            34444444444443


No 78 
>PF15431 TMEM190:  Transmembrane protein 190
Probab=30.85  E-value=60  Score=25.52  Aligned_cols=20  Identities=15%  Similarity=0.137  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHHHHHHHHhhc
Q 022977          264 IAGIALLVIFLSSIRRLCDG  283 (289)
Q Consensus       264 ~~~~~~~~~~~~~~~~~~~~  283 (289)
                      -++++++|..++++|+.+++
T Consensus        68 C~gll~Li~~iclFWWAkRr   87 (134)
T PF15431_consen   68 CGGLLLLICSICLFWWAKRR   87 (134)
T ss_pred             HHhHHHHHHHHHHHHHHHHh
Confidence            44566667666766766544


No 79 
>PF03229 Alpha_GJ:  Alphavirus glycoprotein J;  InterPro: IPR004913 The exact function of the herpesvirus glycoprotein J is unknown, but it appears to play a role in the inhibition of apotosis of the host cell [].; GO: 0019050 suppression by virus of host apoptosis
Probab=30.43  E-value=71  Score=25.33  Aligned_cols=28  Identities=25%  Similarity=0.547  Sum_probs=14.8

Q ss_pred             ceEEEEehHHHHHHHHHHHHHHH-HHHHh
Q 022977          254 EKTLAILIGMIAGIALLVIFLSS-IRRLC  281 (289)
Q Consensus       254 ~~~~~Ivv~~~~~~~~~~~~~~~-~~~~~  281 (289)
                      ..++-.|||-+.++++..++... ++|++
T Consensus        83 d~aLp~VIGGLcaL~LaamGA~~LLrR~c  111 (126)
T PF03229_consen   83 DFALPLVIGGLCALTLAAMGAGALLRRCC  111 (126)
T ss_pred             ccchhhhhhHHHHHHHHHHHHHHHHHHHH
Confidence            34565666665555555555543 44433


No 80 
>PF12606 RELT:  Tumour necrosis factor receptor superfamily member 19;  InterPro: IPR022248 The members of tumor necrosis factor receptor (TNFR) superfamily have been designated as the "guardians of the immune system" due to their roles in immune cell proliferation, differentiation, activation, and death (apoptosis).  RELT (receptor expressed in lymphoid tissues) is a member of the TNFR superfamily. The messenger RNA of RELT is especially abundant in hematologic tissues such as spleen, lymph node, and peripheral blood leukocytes as well as in leukemias and lymphomas. RELT is able to activate the NF-kappaB pathway and selectively binds tumor necrosis factor receptor-associated factor 1 []. RELT like proteins 1 and 2 (RELL1 and RELL2) are two RELT homologues that bind to RELT. The expression of RELL1 at the mRNA level is ubiquitous, whereas expression of RELL2 mRNA is more restricted to particular tissues [].
Probab=29.30  E-value=61  Score=21.72  Aligned_cols=19  Identities=11%  Similarity=0.275  Sum_probs=10.0

Q ss_pred             EEEehHHHHHHHHHHHHHH
Q 022977          257 LAILIGMIAGIALLVIFLS  275 (289)
Q Consensus       257 ~~Ivv~~~~~~~~~~~~~~  275 (289)
                      +.++|+++..++++.+.++
T Consensus         3 ~~~iV~i~iv~~lLg~~I~   21 (50)
T PF12606_consen    3 AFLIVSIFIVMGLLGLSIC   21 (50)
T ss_pred             ehHHHHHHHHHHHHHHHHH
Confidence            3456666555555444444


No 81 
>PF06024 DUF912:  Nucleopolyhedrovirus protein of unknown function (DUF912);  InterPro: IPR009261 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf78; it is a family of uncharacterised viral proteins.
Probab=29.26  E-value=5.8  Score=30.58  Aligned_cols=16  Identities=31%  Similarity=0.476  Sum_probs=7.5

Q ss_pred             EEEEehHHHHHHHHHH
Q 022977          256 TLAILIGMIAGIALLV  271 (289)
Q Consensus       256 ~~~Ivv~~~~~~~~~~  271 (289)
                      ..+|++++++.+++++
T Consensus        61 ~~iili~lls~v~IlV   76 (101)
T PF06024_consen   61 GNIILISLLSFVCILV   76 (101)
T ss_pred             ccchHHHHHHHHHHHH
Confidence            4455555544444333


No 82 
>PF14991 MLANA:  Protein melan-A; PDB: 2GTZ_F 2GT9_F 3MRO_P 2GUO_C 3MRQ_P 2GTW_C 3L6F_C 3MRP_P.
Probab=28.82  E-value=16  Score=28.86  Aligned_cols=11  Identities=27%  Similarity=0.063  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHH
Q 022977          270 LVIFLSSIRRL  280 (289)
Q Consensus       270 ~~~~~~~~~~~  280 (289)
                      +++++.|.|||
T Consensus        40 LliGCWYckRR   50 (118)
T PF14991_consen   40 LLIGCWYCKRR   50 (118)
T ss_dssp             -----------
T ss_pred             HHHhheeeeec
Confidence            33444444444


No 83 
>PF12768 Rax2:  Cortical protein marker for cell polarity
Probab=28.07  E-value=44  Score=30.65  Aligned_cols=26  Identities=38%  Similarity=0.507  Sum_probs=14.5

Q ss_pred             EEEEehHHHHHHHHHHHHHHHHHHHh
Q 022977          256 TLAILIGMIAGIALLVIFLSSIRRLC  281 (289)
Q Consensus       256 ~~~Ivv~~~~~~~~~~~~~~~~~~~~  281 (289)
                      -++|.++++..++++-+++.+++|++
T Consensus       233 slAiALG~v~ll~l~Gii~~~~~r~~  258 (281)
T PF12768_consen  233 SLAIALGTVFLLVLIGIILAYIRRRR  258 (281)
T ss_pred             ehHHHHHHHHHHHHHHHHHHHHHhhh
Confidence            36666666665555555555555543


No 84 
>TIGR00739 yajC preprotein translocase, YajC subunit. While this protein is part of the preprotein translocase in Escherichia coli, it is not essential for viability or protein secretion. The N-terminus region contains a predicted membrane-spanning region followed by a region consisting almost entirely of residues with charged (acidic, basic, or zwitterionic) side chains. This small protein is about 100 residues in length, and is restricted to bacteria; however, this protein is absent from some lineages, including spirochetes and Mycoplasmas.
Probab=27.69  E-value=21  Score=26.54  Aligned_cols=8  Identities=50%  Similarity=0.517  Sum_probs=3.2

Q ss_pred             HHHHHHHH
Q 022977          272 IFLSSIRR  279 (289)
Q Consensus       272 ~~~~~~~~  279 (289)
                      +.+++.+|
T Consensus        15 i~yf~~~r   22 (84)
T TIGR00739        15 IFYFLIIR   22 (84)
T ss_pred             HHHHheec
Confidence            33444433


No 85 
>TIGR01478 STEVOR variant surface antigen, stevor family. This model represents the stevor branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of stevor sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 8 bits.
Probab=27.59  E-value=73  Score=29.30  Aligned_cols=16  Identities=19%  Similarity=0.222  Sum_probs=8.7

Q ss_pred             HHHHHHHHHHHHhhcC
Q 022977          269 LLVIFLSSIRRLCDGK  284 (289)
Q Consensus       269 ~~~~~~~~~~~~~~~~  284 (289)
                      ++|+++.|++||+|+.
T Consensus       274 vliiLYiWlyrrRK~s  289 (295)
T TIGR01478       274 VLIILYIWLYRRRKKS  289 (295)
T ss_pred             HHHHHHHHHHHhhccc
Confidence            3445566666665543


No 86 
>PF05083 LST1:  LST-1 protein;  InterPro: IPR007775 B144/LST1 is a gene encoded in the human major histocompatibility complex that produces multiple forms of alternatively spliced mRNA and encodes peptides fewer than 100 amino acids in length. B144/LST1 is strongly expressed in dendritic cells. Transfection of B144/LST1 into a variety of cells induces morphologic changes including the production of long, thin filopodia []. A possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation [, ]. ; GO: 0000902 cell morphogenesis, 0006955 immune response, 0016020 membrane
Probab=27.48  E-value=80  Score=22.69  Aligned_cols=20  Identities=20%  Similarity=0.247  Sum_probs=12.6

Q ss_pred             HHHHHHHHHHHHHHHhhcCC
Q 022977          266 GIALLVIFLSSIRRLCDGKG  285 (289)
Q Consensus       266 ~~~~~~~~~~~~~~~~~~~~  285 (289)
                      +++++.+|++++.||.++.+
T Consensus         8 ~vvll~~clC~lsrRvkrLE   27 (74)
T PF05083_consen    8 AVVLLSACLCRLSRRVKRLE   27 (74)
T ss_pred             HHHHHHHHHHHHHhhhhhcc
Confidence            34555577887777766543


No 87 
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional
Probab=26.36  E-value=39  Score=27.32  Aligned_cols=7  Identities=14%  Similarity=0.410  Sum_probs=3.3

Q ss_pred             CeeEEEc
Q 022977          227 KCYARYS  233 (289)
Q Consensus       227 ~C~lRYe  233 (289)
                      .|.+--+
T Consensus        57 ~C~yI~d   63 (139)
T PHA03099         57 DCIHARD   63 (139)
T ss_pred             EEEeecc
Confidence            4554444


No 88 
>PF04246 RseC_MucC:  Positive regulator of sigma(E), RseC/MucC;  InterPro: IPR007359 This bacterial family of integral membrane proteins represents a positive regulator of the sigma(E) transcription factor, namely RseC/MucC. The sigma(E) transcription factor is up-regulated by cell envelope protein misfolding, and regulates the expression of genes that are collectively termed ECF (devoted to Extra-Cellular Functions) []. In Pseudomonas aeruginosa, derepression of sigma(E) is associated with the alginate-overproducing phenotype characteristic of chronic respiratory tract colonization in cystic fibrosis patients. The mechanism by which RseC/MucC positively regulates the sigma(E) transcription factor is unknown. RseC is also thought to have a role in thiamine biosynthesis in Salmonella typhimurium []. In addition, this family also includes an N-terminal part of RnfF, a Rhodobacter capsulatus protein, of unknown function, that is essential for nitrogen fixation. This protein also contains a domain found in ApbE protein IPR003374 from INTERPRO, which is itself involved in thiamine biosynthesis.
Probab=26.32  E-value=92  Score=24.86  Aligned_cols=16  Identities=19%  Similarity=0.412  Sum_probs=9.1

Q ss_pred             EEEEEcCCCCChhhHHHHH
Q 022977          186 TGVAQCVGDLSASECQDCL  204 (289)
Q Consensus       186 YglaQC~~DLs~~~C~~CL  204 (289)
                      +..+++.+.   +.|..|=
T Consensus         8 ~~~V~~~r~---saC~~C~   23 (135)
T PF04246_consen    8 IAWVEVQRS---SACGSCS   23 (135)
T ss_pred             EEEEEEccC---CcCcccC
Confidence            555665544   4477773


No 89 
>PHA03265 envelope glycoprotein D; Provisional
Probab=26.29  E-value=93  Score=29.50  Aligned_cols=35  Identities=9%  Similarity=0.243  Sum_probs=19.3

Q ss_pred             cceEEEE-ehHHHHHHHHHHHHHHHHHHHhhcCCCCC
Q 022977          253 IEKTLAI-LIGMIAGIALLVIFLSSIRRLCDGKGKGG  288 (289)
Q Consensus       253 ~~~~~~I-vv~~~~~~~~~~~~~~~~~~~~~~~~~~~  288 (289)
                      .+.+|-. |+|+|++-+++.+| .-.||..+|.++.|
T Consensus       350 ~g~~ig~~i~glv~vg~il~~~-~rr~k~~~k~~~~~  385 (402)
T PHA03265        350 VGISVGLGIAGLVLVGVILYVC-LRRKKELKKSAQNG  385 (402)
T ss_pred             cceEEccchhhhhhhhHHHHHH-hhhhhhhhhhhhcC
Confidence            3555444 55555444444444 46777776666654


No 90 
>PF00974 Rhabdo_glycop:  Rhabdovirus spike glycoprotein;  InterPro: IPR001903 Different families of ssRNA negative-strand viruses contain glycoproteins responsible for forming spikes on the surface of the virion. The glycoprotein spike is made up of a trimer of glycoproteins. These proteins are frequently abbreviated to G protein. Channel formed by glycoprotein spike is thought to function in a similar manner to Influenza virus M2 protein channel, thus allowing a signal to pass across the viral membrane to signal for viral uncoating [, ].; GO: 0019031 viral envelope; PDB: 2CMZ_C 2J6J_A 3EGD_D.
Probab=25.37  E-value=23  Score=35.18  Aligned_cols=15  Identities=13%  Similarity=-0.004  Sum_probs=10.2

Q ss_pred             cEEEEEEcCCCCChh
Q 022977          184 DVTGVAQCVGDLSAS  198 (289)
Q Consensus       184 ~vYglaQC~~DLs~~  198 (289)
                      ..|--+-++.+..++
T Consensus       341 ~~Y~~V~~~~~i~~~  355 (501)
T PF00974_consen  341 THYKRVDIWGPIIPS  355 (501)
T ss_dssp             EEEEEEEESSSEESS
T ss_pred             EEEEEEeccCccccc
Confidence            468888887776543


No 91 
>PF05393 Hum_adeno_E3A:  Human adenovirus early E3A glycoprotein;  InterPro: IPR008652 This family consists of several early glycoproteins (E3A), from human adenovirus type 2.; GO: 0016021 integral to membrane
Probab=25.27  E-value=1.1e+02  Score=23.05  Aligned_cols=11  Identities=36%  Similarity=0.594  Sum_probs=4.5

Q ss_pred             hHHHHHHHHHH
Q 022977          261 IGMIAGIALLV  271 (289)
Q Consensus       261 v~~~~~~~~~~  271 (289)
                      +.++.++.+++
T Consensus        37 ~lvI~~iFil~   47 (94)
T PF05393_consen   37 FLVICGIFILL   47 (94)
T ss_pred             HHHHHHHHHHH
Confidence            34444443333


No 92 
>PTZ00370 STEVOR; Provisional
Probab=24.53  E-value=78  Score=29.14  Aligned_cols=15  Identities=20%  Similarity=0.268  Sum_probs=8.0

Q ss_pred             HHHHHHHHHHHHhhc
Q 022977          269 LLVIFLSSIRRLCDG  283 (289)
Q Consensus       269 ~~~~~~~~~~~~~~~  283 (289)
                      ++|+++.|++||+|+
T Consensus       270 vliilYiwlyrrRK~  284 (296)
T PTZ00370        270 VLIILYIWLYRRRKN  284 (296)
T ss_pred             HHHHHHHHHHHhhcc
Confidence            344456666665544


No 93 
>PF12575 DUF3753:  Protein of unknown function (DUF3753);  InterPro: IPR009175 This group represents an uncharacterised conserved protein belonging to poxvirus family I2.
Probab=24.14  E-value=33  Score=24.81  Aligned_cols=19  Identities=11%  Similarity=0.301  Sum_probs=7.8

Q ss_pred             EEehHHHHHHHHHHHHHHH
Q 022977          258 AILIGMIAGIALLVIFLSS  276 (289)
Q Consensus       258 ~Ivv~~~~~~~~~~~~~~~  276 (289)
                      .+++.++.+++++++++.|
T Consensus        50 ~~ii~ii~v~ii~~l~flY   68 (72)
T PF12575_consen   50 ILIISIIFVLIIVLLTFLY   68 (72)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            3444444444433343333


No 94 
>COG3765 WzzB Chain length determinant protein [Cell envelope biogenesis, outer membrane]
Probab=24.03  E-value=76  Score=29.99  Aligned_cols=24  Identities=8%  Similarity=0.239  Sum_probs=12.4

Q ss_pred             CCCCCCCCCcceEEEEehHHHHHH
Q 022977          244 DNDDDNDEEIEKTLAILIGMIAGI  267 (289)
Q Consensus       244 ~~~~~~~~~~~~~~~Ivv~~~~~~  267 (289)
                      |+.|-+..+.++.+.+|++.+++.
T Consensus       305 P~~Pvkrd~PrrA~ilil~~LiGg  328 (347)
T COG3765         305 PTLPVKRDSPRRAIILILGALIGG  328 (347)
T ss_pred             CCCCCcCCCcchHHHHHHHHHHHH
Confidence            444555556566554555554443


No 95 
>PTZ00230 variable surface protein Vir7; Provisional
Probab=23.38  E-value=1.4e+02  Score=28.42  Aligned_cols=23  Identities=4%  Similarity=0.016  Sum_probs=13.8

Q ss_pred             CCcceEEEEehHHHHHHHHHHHH
Q 022977          251 EEIEKTLAILIGMIAGIALLVIF  273 (289)
Q Consensus       251 ~~~~~~~~Ivv~~~~~~~~~~~~  273 (289)
                      +.++|.|++.++++++++.++++
T Consensus       288 ~~~~~~~~~~~~~~g~~~~~~~~  310 (364)
T PTZ00230        288 SITSKSITGAVSVAGFLVPSYLM  310 (364)
T ss_pred             CccccceeeeeehHHHHHHHHHH
Confidence            45667777777766554444443


No 96 
>PRK14766 lipoprotein signal peptidase; Provisional
Probab=22.83  E-value=25  Score=30.70  Aligned_cols=16  Identities=25%  Similarity=0.266  Sum_probs=8.1

Q ss_pred             EEEehHHHHHHHHHHH
Q 022977          257 LAILIGMIAGIALLVI  272 (289)
Q Consensus       257 ~~Ivv~~~~~~~~~~~  272 (289)
                      ++|++|++++++++++
T Consensus       162 i~I~iG~~l~vi~li~  177 (201)
T PRK14766        162 LYVNIAIGLTILFTII  177 (201)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            4466665554444433


No 97 
>PF05337 CSF-1:  Macrophage colony stimulating factor-1 (CSF-1);  InterPro: IPR008001 Colony stimulating factor 1 (CSF-1) is a homodimeric polypeptide growth factor whose primary function is to regulate the survival, proliferation, differentiation, and function of cells of the mononuclear phagocytic lineage. This lineage includes mononuclear phagocytic precursors, blood monocytes, tissue macrophages, osteoclasts, and microglia of the brain, all of which possess cell surface receptors for CSF-1. The protein has also been linked with male fertility [] and mutations in the Csf-1 gene have been found to cause osteopetrosis and failure of tooth eruption [].; GO: 0005125 cytokine activity, 0008083 growth factor activity, 0016021 integral to membrane; PDB: 3EJJ_A.
Probab=22.22  E-value=29  Score=31.64  Aligned_cols=28  Identities=25%  Similarity=0.090  Sum_probs=0.0

Q ss_pred             EEEEehHHHHHHHHHHHHHHHHHHHhhc
Q 022977          256 TLAILIGMIAGIALLVIFLSSIRRLCDG  283 (289)
Q Consensus       256 ~~~Ivv~~~~~~~~~~~~~~~~~~~~~~  283 (289)
                      +..+.||.|+.|++.+-++.|+|||+|.
T Consensus       227 vf~lLVPSiILVLLaVGGLLfYr~rrRs  254 (285)
T PF05337_consen  227 VFYLLVPSIILVLLAVGGLLFYRRRRRS  254 (285)
T ss_dssp             ----------------------------
T ss_pred             cccccccchhhhhhhccceeeecccccc
Confidence            3344555544444444456666665544


No 98 
>PF10883 DUF2681:  Protein of unknown function (DUF2681);  InterPro: IPR020274 This entry contains membrane proteins with no known function.
Probab=22.21  E-value=61  Score=24.37  Aligned_cols=15  Identities=13%  Similarity=0.397  Sum_probs=6.0

Q ss_pred             hHHHHHHHHHHHHHH
Q 022977          261 IGMIAGIALLVIFLS  275 (289)
Q Consensus       261 v~~~~~~~~~~~~~~  275 (289)
                      ++++++++++++++.
T Consensus         7 v~~~~~v~~~i~~y~   21 (87)
T PF10883_consen    7 VGGVGAVVALILAYL   21 (87)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            334444444443333


No 99 
>PF12301 CD99L2:  CD99 antigen like protein 2;  InterPro: IPR022078  This family of proteins is found in eukaryotes. Proteins in this family are typically between 165 and 237 amino acids in length. CD99L2 and CD99 are involved in trans-endothelial migration of neutrophils in vitro and in the recruitment of neutrophils into inflamed peritoneum. 
Probab=22.21  E-value=93  Score=26.36  Aligned_cols=10  Identities=10%  Similarity=0.614  Sum_probs=4.5

Q ss_pred             EehHHHHHHH
Q 022977          259 ILIGMIAGIA  268 (289)
Q Consensus       259 Ivv~~~~~~~  268 (289)
                      +|.|||.+|+
T Consensus       116 ~IaGIvsav~  125 (169)
T PF12301_consen  116 TIAGIVSAVV  125 (169)
T ss_pred             hhhhHHHHHH
Confidence            4445544443


No 100
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms]
Probab=22.19  E-value=73  Score=32.61  Aligned_cols=8  Identities=13%  Similarity=0.584  Sum_probs=3.8

Q ss_pred             CCCChhHH
Q 022977           45 TPGSAYEN   52 (289)
Q Consensus        45 ~~~s~f~~   52 (289)
                      ++.|.|.+
T Consensus        42 sASSs~dq   49 (807)
T KOG1094|consen   42 SASSSFDQ   49 (807)
T ss_pred             cccccccc
Confidence            44455553


No 101
>PRK10381 LPS O-antigen length regulator; Provisional
Probab=20.31  E-value=90  Score=29.84  Aligned_cols=26  Identities=15%  Similarity=0.198  Sum_probs=14.8

Q ss_pred             CCCCCCCCCcceEEEEehHHHHHHHH
Q 022977          244 DNDDDNDEEIEKTLAILIGMIAGIAL  269 (289)
Q Consensus       244 ~~~~~~~~~~~~~~~Ivv~~~~~~~~  269 (289)
                      |..|-+..+.++.+++|++.++|+++
T Consensus       327 p~~P~~rd~Pkr~lIlvl~~llG~~l  352 (377)
T PRK10381        327 PSLPVKKDGPGKALIVILAALIGGML  352 (377)
T ss_pred             CcCCCCCCCcchhHHHHHHHHHHHHH
Confidence            33444555666666666666665443


No 102
>PTZ00208 65 kDa invariant surface glycoprotein; Provisional
Probab=20.13  E-value=18  Score=34.74  Aligned_cols=11  Identities=9%  Similarity=0.199  Sum_probs=8.3

Q ss_pred             CCcceEEEcCC
Q 022977          217 AAKWGDMFLAK  227 (289)
Q Consensus       217 ~~~ggri~~~~  227 (289)
                      +++|+.|..|.
T Consensus       316 ~~kgak~~~p~  326 (436)
T PTZ00208        316 GKKGAKIIIPA  326 (436)
T ss_pred             cccCceeecCC
Confidence            57788887765


Done!