Citrus Sinensis ID: 022985


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MYLFANCVAFFKCDYEGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMAEHKIQSGSGPLDMQLLQVPKMLSVLRKEWAPMAFCISFKLETDAEILLEKADMARKKYGMHAVVANELLSRKEQVVVVTNNGKIPVYRDKTSSDSDVEKPLTKLLVDRHSVYIKDSNT
ccHHHHHHHHHcccccccccEEEEEccccccccccccEEEEEcccccccHHHHHHHHHHcccEEEEEEccccccccccccccccccccccccccccEEEccccHHHHHHHHHHHHHHHHccEEccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHcccccccccccccccccccccccEEEEEEccccHHHHHHccccccEEEEEEEEccHHHHHHHHHHHHHHHcccEEEEEEccccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccc
MYLFANCVAFFKCDYEGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMAEHKIQSGSGPLDMQLLQVPKMLSVLRKEWAPMAFCISFKLETDAEILLEKADMARKKYGMHAVVANELLSRKEQVVVVTNNGKIPVY********DVEKPLTKLLVDRHSVYI*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLFANCVAFFKCDYEGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQVCQPYSEAVKRAIRDHHAAVAGGLLLKLPFTTIFEYLQMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMAEHKIQSGSGPLDMQLLQVPKMLSVLRKEWAPMAFCISFKLETDAEILLEKADMARKKYGMHAVVANELLSRKEQVVVVTNNGKIPVYRDKTSSDSDVEKPLTKLLVDRHSVYIKDSNT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphopantothenate--cysteine ligase 1 Catalyzes the first step in the biosynthesis of coenzyme A from vitamin B5, where cysteine is conjugated to 4'-phosphopantothenate to form 4-phosphopantothenoylcysteine.confidentQ8GXR5
Phosphopantothenate--cysteine ligase Catalyzes the first step in the biosynthesis of coenzyme A from vitamin B5, where cysteine is conjugated to 4'-phosphopantothenate to form 4-phosphopantothenoylcysteine.probableQ8VDG5
Phosphopantothenate--cysteine ligase Catalyzes the first step in the biosynthesis of coenzyme A from vitamin B5, where cysteine is conjugated to 4'-phosphopantothenate to form 4-phosphopantothenoylcysteine.probableQ9HAB8

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.3.-.-Forming carbon-nitrogen bonds.probable
6.3.2.-Acid--D-amino-acid ligases (peptide synthases).probable
6.3.2.5Phosphopantothenate--cysteine ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1P9O, chain A
Confidence level:very confident
Coverage over the Query: 2-166,181-284
View the alignment between query and template
View the model in PyMOL