BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 022987
         (289 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3MDU|A Chain A, The Structure Of N-Formimino-L-Glutamate Iminohydrolase
           From Pseudomonas Aeruginosa Complexed With
           N-Guanidino-L-Glutamate
 pdb|3MDW|A Chain A, The Structure Of N-Formimino-L-Glutamate Iminohydrolase
           From Pseudomonas Aeruginosa Complexed With
           N-Formimino-L-Aspartate
 pdb|3MDW|B Chain B, The Structure Of N-Formimino-L-Glutamate Iminohydrolase
           From Pseudomonas Aeruginosa Complexed With
           N-Formimino-L-Aspartate
 pdb|3MDW|C Chain C, The Structure Of N-Formimino-L-Glutamate Iminohydrolase
           From Pseudomonas Aeruginosa Complexed With
           N-Formimino-L-Aspartate
 pdb|3MDW|D Chain D, The Structure Of N-Formimino-L-Glutamate Iminohydrolase
           From Pseudomonas Aeruginosa Complexed With
           N-Formimino-L-Aspartate
          Length = 453

 Score = 28.1 bits (61), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 2/42 (4%)

Query: 91  IIGLCSIMSKDPGLITNEFPHLDKLVEGSELGVDPDNENSLS 132
           + GLC  +S +  L    FP  D L +G  LG+  D+  SLS
Sbjct: 287 VAGLC--LSTEANLGDGIFPATDFLAQGGRLGIGSDSHVSLS 326


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.140    0.454 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,037,597
Number of Sequences: 62578
Number of extensions: 307762
Number of successful extensions: 861
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 861
Number of HSP's gapped (non-prelim): 3
length of query: 289
length of database: 14,973,337
effective HSP length: 98
effective length of query: 191
effective length of database: 8,840,693
effective search space: 1688572363
effective search space used: 1688572363
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)