Citrus Sinensis ID: 022993


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MGQALGCIQVDQSTVAIKETFGKFDDVLEPGCHCLPWCLGSQVAGQLSLRVQQLDVRCETKTKDNVFVNVVASVQYRALAEKASDAFYKLSNTRSQIQAYVFDVIRASVPKLDLDATFEQKNDIAKAVEEELEKAMSHYGYEIVQTLIVDIEPDEHVKRAMNEINAAARLRLAANEKAEAEKILQIKRAEGEAESKYLAGLGIARQRQAIVDGLRDSVLAFSENVPGTSSKDVMDMVLVTQYFDTMKEIGASSKTNSVFIPHGPGAVKDIASQIREGLLQANATTYLKL
ccccEEEEEEccccEEEEEcccccccccccccCEEccccccccccccccEEEEcccccccccccccEEEEcEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHHHHcccccccc
***ALGCIQVDQSTVAIKETFGKFDDVLEPGCHCLPWCLGSQVAGQLSLRVQQLDVRCETKTKDNVFVNVVASVQYRALAEKASDAFYKLSNTRSQIQAYVFDVIRASVPKLDLDATFEQKNDIAKAVEEELEKAMSHYGYEIVQTLIVDIEPDEHVKRAMNEINAAARLRLAANEKAEAEKILQIKRAEGEAESKYLAGLGIARQRQAIVDGLRDSVLAFSENVPGTSSKDVMDMVLVTQYFDTMKEIGASSKTNSVFIPHGPGAVKDIASQIREGLLQ*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGQALGCIQVDQSTVAIKETFGKFDDVLEPGCHCLPWCLGSQVAGQLSLRVQQLDVRCETKTKDNVFVNVVASVQYRALAEKASDAFYKLSNTRSQIQAYVFDVIRASVPKLDLDATFEQKNDIAKAVEEELEKAMSHYGYEIVQTLIVDIEPDEHVKRAMNEINAAARxxxxxxxxxxxxxxxxxxxxxGEAESKYLAGLGIARQRQAIVDGLRDSVLAFSENVPGTSSKDVMDMVLVTQYFDTMKEIGASSKTNSVFIPHGPGAVKDIASQIREGLLQANATTYLKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Hypersensitive-induced response protein 2 confidentQ9CAR7
Hypersensitive-induced response protein 1 probableQ9FM19
Hypersensitive-induced response protein 3 probableQ9SRH6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BK6, chain A
Confidence level:very confident
Coverage over the Query: 41-179,191-202,218-245
View the alignment between query and template
View the model in PyMOL
Template: 2ZUO, chain A
Confidence level:confident
Coverage over the Query: 7-162
View the alignment between query and template
View the model in PyMOL