Query         023002
Match_columns 289
No_of_seqs    281 out of 741
Neff          4.1 
Searched_HMMs 46136
Date          Fri Mar 29 07:44:33 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/023002.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/023002hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1813 Predicted E3 ubiquitin 100.0 9.8E-64 2.1E-68  466.2   3.7  220   46-288    41-270 (313)
  2 COG5152 Uncharacterized conser 100.0 1.8E-42 3.9E-47  311.1   3.2   99  173-288   127-225 (259)
  3 PF15227 zf-C3HC4_4:  zinc fing  98.9 7.8E-10 1.7E-14   76.7   1.4   27  262-288     1-27  (42)
  4 KOG0823 Predicted E3 ubiquitin  98.7 1.4E-08 2.9E-13   93.6   3.5   33  256-288    44-76  (230)
  5 PF13923 zf-C3HC4_2:  Zinc fing  98.6 1.7E-08 3.6E-13   68.1   1.1   27  262-288     1-28  (39)
  6 smart00504 Ubox Modified RING   98.4 9.2E-08   2E-12   68.9   1.8   29  260-288     2-30  (63)
  7 PF13445 zf-RING_UBOX:  RING-ty  98.4 9.7E-08 2.1E-12   67.1   0.9   26  262-288     1-30  (43)
  8 KOG0320 Predicted E3 ubiquitin  98.4 1.6E-07 3.5E-12   84.0   2.4   32  257-288   129-162 (187)
  9 PF00097 zf-C3HC4:  Zinc finger  98.3 2.8E-07 6.2E-12   61.9   1.2   27  262-288     1-28  (41)
 10 KOG0317 Predicted E3 ubiquitin  98.2 4.2E-07 9.1E-12   86.2   1.7   30  259-288   239-268 (293)
 11 KOG2164 Predicted E3 ubiquitin  98.1 8.6E-07 1.9E-11   89.4   1.5   30  259-288   186-215 (513)
 12 PF14634 zf-RING_5:  zinc-RING   98.1 1.8E-06 3.8E-11   59.8   1.9   28  261-288     1-31  (44)
 13 smart00184 RING Ring finger. E  98.0 3.4E-06 7.4E-11   53.3   2.2   26  262-287     1-26  (39)
 14 COG5574 PEX10 RING-finger-cont  98.0 2.8E-06 6.1E-11   79.9   1.7   30  259-288   215-244 (271)
 15 PF00642 zf-CCCH:  Zinc finger   98.0 7.2E-07 1.6E-11   56.7  -1.6   27  185-211     1-27  (27)
 16 smart00356 ZnF_C3H1 zinc finge  98.0 3.4E-06 7.4E-11   51.9   1.5   26  185-211     2-27  (27)
 17 PF04564 U-box:  U-box domain;   97.8 5.7E-06 1.2E-10   63.0   1.2   30  259-288     4-33  (73)
 18 PF13920 zf-C3HC4_3:  Zinc fing  97.8 6.2E-06 1.3E-10   58.1   1.2   29  260-288     3-32  (50)
 19 cd00162 RING RING-finger (Real  97.7 1.4E-05   3E-10   52.2   1.5   27  261-287     1-28  (45)
 20 PF13639 zf-RING_2:  Ring finge  97.6 1.6E-05 3.6E-10   54.4   0.8   28  261-288     2-32  (44)
 21 PF14835 zf-RING_6:  zf-RING of  97.6 2.1E-05 4.5E-10   60.3   0.5   28  260-287     8-36  (65)
 22 KOG0978 E3 ubiquitin ligase in  97.5   3E-05 6.5E-10   81.2   0.1   30  258-287   642-671 (698)
 23 PHA02929 N1R/p28-like protein;  97.4 6.9E-05 1.5E-09   69.6   2.2   30  259-288   174-211 (238)
 24 PF11789 zf-Nse:  Zinc-finger o  97.3 8.9E-05 1.9E-09   54.9   1.4   33  256-288     8-41  (57)
 25 COG5222 Uncharacterized conser  97.2 0.00036 7.9E-09   67.6   4.3   75  205-288   229-304 (427)
 26 KOG4159 Predicted E3 ubiquitin  97.1 0.00016 3.5E-09   71.6   0.7   32  257-288    82-113 (398)
 27 PHA02926 zinc finger-like prot  96.7 0.00071 1.5E-08   63.0   1.6   29  260-288   171-208 (242)
 28 KOG0311 Predicted E3 ubiquitin  96.0 0.00073 1.6E-08   66.3  -2.6   32  257-288    41-73  (381)
 29 KOG2879 Predicted E3 ubiquitin  95.7  0.0047   1E-07   59.1   1.6   31  258-288   238-269 (298)
 30 PF12678 zf-rbx1:  RING-H2 zinc  95.2  0.0086 1.9E-07   45.8   1.3   28  261-288    21-61  (73)
 31 KOG1677 CCCH-type Zn-finger pr  95.0   0.011 2.4E-07   55.5   1.7   33  180-212   170-202 (332)
 32 KOG3039 Uncharacterized conser  95.0  0.0095 2.1E-07   56.6   1.1   30  259-288    42-72  (303)
 33 KOG1001 Helicase-like transcri  94.7   0.016 3.5E-07   61.0   1.9   29  260-289   455-483 (674)
 34 KOG1002 Nucleotide excision re  94.4   0.015 3.2E-07   60.3   0.9   33  255-287   532-564 (791)
 35 KOG0825 PHD Zn-finger protein   92.2   0.029 6.3E-07   60.3  -1.1   30  259-288   123-155 (1134)
 36 KOG0802 E3 ubiquitin ligase [P  91.8   0.068 1.5E-06   54.5   1.1   29  260-288   292-325 (543)
 37 KOG4692 Predicted E3 ubiquitin  90.3    0.13 2.8E-06   51.3   1.3   28  261-288   424-451 (489)
 38 KOG1039 Predicted E3 ubiquitin  89.6    0.14 3.1E-06   50.3   1.0   30  259-288   161-198 (344)
 39 KOG4172 Predicted E3 ubiquitin  89.6     0.1 2.2E-06   39.5  -0.0   28  261-288     9-37  (62)
 40 KOG1814 Predicted E3 ubiquitin  89.0    0.18 3.9E-06   50.8   1.2   31  257-287   182-215 (445)
 41 PF14608 zf-CCCH_2:  Zinc finge  88.6    0.24 5.2E-06   29.3   1.1   19  189-210     1-19  (19)
 42 PF04641 Rtf2:  Rtf2 RING-finge  88.4    0.33 7.1E-06   45.1   2.5   35  255-289   109-147 (260)
 43 KOG3039 Uncharacterized conser  88.3    0.23 4.9E-06   47.5   1.3   31  258-288   220-254 (303)
 44 KOG1039 Predicted E3 ubiquitin  86.9    0.57 1.2E-05   46.1   3.2   15  196-210   101-115 (344)
 45 PF12861 zf-Apc11:  Anaphase-pr  85.5    0.48 1.1E-05   38.2   1.6   16  273-288    48-63  (85)
 46 KOG0826 Predicted E3 ubiquitin  83.2     0.5 1.1E-05   46.6   0.9   32  257-288   298-330 (357)
 47 KOG1677 CCCH-type Zn-finger pr  82.6    0.45 9.7E-06   44.8   0.3   29  185-213   130-159 (332)
 48 PF10367 Vps39_2:  Vacuolar sor  81.5     0.6 1.3E-05   36.3   0.7   27  261-287    80-108 (109)
 49 PF03194 LUC7:  LUC7 N_terminus  81.3    0.33 7.2E-06   45.5  -1.0   42  167-210    11-61  (254)
 50 KOG1812 Predicted E3 ubiquitin  79.1    0.88 1.9E-05   45.0   1.1   33  256-288   143-179 (384)
 51 KOG1815 Predicted E3 ubiquitin  78.0     1.4   3E-05   44.1   2.0   31  257-287    68-99  (444)
 52 PF14447 Prok-RING_4:  Prokaryo  77.9    0.83 1.8E-05   34.2   0.4   27  260-286     8-34  (55)
 53 COG5236 Uncharacterized conser  77.9     1.4   3E-05   44.2   2.0   29  260-288    62-90  (493)
 54 KOG1571 Predicted E3 ubiquitin  76.2     1.7 3.7E-05   43.1   2.1   30  253-282   299-328 (355)
 55 KOG4265 Predicted E3 ubiquitin  75.0     2.4 5.2E-05   42.0   2.8   33  255-287   286-319 (349)
 56 cd00065 FYVE FYVE domain; Zinc  73.7     1.8 3.9E-05   30.6   1.2   27  261-287     4-34  (57)
 57 KOG4628 Predicted E3 ubiquitin  72.8     2.1 4.5E-05   42.4   1.8   30  258-287   228-260 (348)
 58 KOG1785 Tyrosine kinase negati  72.7     1.6 3.4E-05   44.5   0.9   27  261-287   371-397 (563)
 59 KOG2333 Uncharacterized conser  71.4     1.1 2.4E-05   46.5  -0.5   20  197-216    88-107 (614)
 60 KOG0298 DEAD box-containing he  68.7     1.4 3.1E-05   49.8  -0.4   31  257-287  1151-1182(1394)
 61 COG5540 RING-finger-containing  65.1     2.7 5.8E-05   41.5   0.7   32  257-288   321-355 (374)
 62 KOG1763 Uncharacterized conser  64.7     1.7 3.7E-05   42.5  -0.6   29  183-212    88-116 (343)
 63 PF13465 zf-H2C2_2:  Zinc-finge  63.8     3.3 7.3E-05   25.7   0.8   14  258-271    13-26  (26)
 64 KOG2185 Predicted RNA-processi  62.1     2.9 6.2E-05   42.6   0.3   23  188-211   141-163 (486)
 65 smart00064 FYVE Protein presen  62.1     5.4 0.00012   29.2   1.7   28  260-287    11-42  (68)
 66 KOG0804 Cytoplasmic Zn-finger   59.0     4.4 9.6E-05   41.6   1.1   32  256-288   173-208 (493)
 67 PF01363 FYVE:  FYVE zinc finge  58.8     2.1 4.6E-05   31.5  -0.9   28  260-287    10-41  (69)
 68 KOG4275 Predicted E3 ubiquitin  58.6     3.4 7.5E-05   40.5   0.2   27  259-285   300-327 (350)
 69 PF10235 Cript:  Microtubule-as  52.7     6.6 0.00014   32.1   0.9   23  261-288    46-68  (90)
 70 KOG1814 Predicted E3 ubiquitin  52.4     1.2 2.7E-05   45.1  -4.0   32  256-287   365-402 (445)
 71 KOG2979 Protein involved in DN  51.4     5.6 0.00012   38.1   0.4   32  256-287   173-205 (262)
 72 KOG2932 E3 ubiquitin ligase in  51.1     6.4 0.00014   39.0   0.7   28  260-287    91-119 (389)
 73 KOG0796 Spliceosome subunit [R  48.7     3.7   8E-05   40.3  -1.3   41  168-210    13-62  (319)
 74 KOG0828 Predicted E3 ubiquitin  45.5     8.7 0.00019   40.2   0.7   30  259-288   571-617 (636)
 75 PF00096 zf-C2H2:  Zinc finger,  45.4     7.6 0.00016   22.6   0.2   14  260-273     1-14  (23)
 76 KOG1812 Predicted E3 ubiquitin  45.3     9.4  0.0002   37.9   0.9   29  259-287   306-339 (384)
 77 KOG4445 Uncharacterized conser  43.9     9.2  0.0002   37.8   0.6   29  260-288   116-147 (368)
 78 PHA03096 p28-like protein; Pro  43.3      12 0.00027   35.9   1.3   28  260-287   179-214 (284)
 79 PF13912 zf-C2H2_6:  C2H2-type   42.8      10 0.00023   22.8   0.5   13  259-271     1-13  (27)
 80 KOG2817 Predicted E3 ubiquitin  42.3      13 0.00028   37.6   1.3   31  257-287   332-365 (394)
 81 KOG1734 Predicted RING-contain  41.7      11 0.00024   36.7   0.8   27  261-287   226-262 (328)
 82 PF05883 Baculo_RING:  Baculovi  41.0      13 0.00028   32.4   1.0   31  258-288    25-64  (134)
 83 PF02318 FYVE_2:  FYVE-type zin  40.7     9.8 0.00021   31.4   0.2   28  260-287    55-87  (118)
 84 KOG3579 Predicted E3 ubiquitin  39.2      10 0.00023   37.2   0.1   32  256-287   265-300 (352)
 85 PF13894 zf-C2H2_4:  C2H2-type   39.1      11 0.00025   21.2   0.2   13  260-272     1-13  (24)
 86 KOG2034 Vacuolar sorting prote  38.1      13 0.00028   41.1   0.6   28  261-288   819-848 (911)
 87 KOG1940 Zn-finger protein [Gen  37.6      12 0.00027   36.0   0.4   32  255-286   154-189 (276)
 88 KOG3002 Zn finger protein [Gen  37.6      17 0.00036   35.3   1.3   31  258-288    47-78  (299)
 89 PF10764 Gin:  Inhibitor of sig  36.9      15 0.00033   26.3   0.6   26  261-287     1-26  (46)
 90 KOG3476 Microtubule-associated  36.9      11 0.00024   31.0  -0.0   24  260-288    55-78  (100)
 91 PF07975 C1_4:  TFIIH C1-like d  36.7      21 0.00045   26.3   1.3   12  275-286    25-36  (51)
 92 COG5243 HRD1 HRD ubiquitin lig  34.2      20 0.00044   36.5   1.2   27  261-287   289-328 (491)
 93 PF10571 UPF0547:  Uncharacteri  32.9      25 0.00053   22.4   1.1   21  261-281     2-24  (26)
 94 smart00154 ZnF_AN1 AN1-like Zi  32.7      25 0.00055   24.1   1.2   11  259-269    12-22  (39)
 95 PTZ00303 phosphatidylinositol   32.2      24 0.00052   39.2   1.5   28  260-287   461-497 (1374)
 96 smart00647 IBR In Between Ring  31.3      14  0.0003   26.1  -0.3   12  276-287    45-56  (64)
 97 KOG1040 Polyadenylation factor  31.2      15 0.00033   36.0  -0.1   41  167-210    59-99  (325)
 98 smart00744 RINGv The RING-vari  31.2      36 0.00078   24.2   1.8   27  261-287     1-34  (49)
 99 COG4647 AcxC Acetone carboxyla  30.6      22 0.00047   31.5   0.7   22  262-283    60-81  (165)
100 KOG2494 C3H1-type Zn-finger pr  30.1      10 0.00022   37.5  -1.6   26  203-228    85-110 (331)
101 KOG2114 Vacuolar assembly/sort  28.4      32 0.00069   38.1   1.6   27  261-287   842-869 (933)
102 KOG1729 FYVE finger containing  27.5      19 0.00041   34.8  -0.2   29  259-287   168-201 (288)
103 PF06827 zf-FPG_IleRS:  Zinc fi  27.4      10 0.00022   24.1  -1.4   26  261-286     3-28  (30)
104 TIGR00622 ssl1 transcription f  27.3      29 0.00062   29.4   0.9   27  261-287    57-97  (112)
105 KOG0825 PHD Zn-finger protein   27.2      50  0.0011   36.7   2.8   28  261-288    98-132 (1134)
106 KOG1492 C3H1-type Zn-finger pr  27.2      26 0.00055   33.7   0.6   31  182-212   281-313 (377)
107 PF12874 zf-met:  Zinc-finger o  26.5      24 0.00051   20.9   0.2   15  260-274     1-15  (25)
108 PF00412 LIM:  LIM domain;  Int  25.8      36 0.00077   23.6   1.0   31  258-288    25-56  (58)
109 KOG1100 Predicted E3 ubiquitin  24.1      29 0.00063   31.8   0.4   25  262-286   161-186 (207)
110 COG5063 CTH1 CCCH-type Zn-fing  23.7      38 0.00083   33.6   1.1   23  188-210   275-297 (351)
111 smart00451 ZnF_U1 U1-like zinc  23.4      39 0.00084   21.3   0.7   15  259-273     3-17  (35)
112 PF07191 zinc-ribbons_6:  zinc-  23.3      17 0.00037   28.5  -1.1   13  273-285    42-56  (70)
113 PF08273 Prim_Zn_Ribbon:  Zinc-  23.0      26 0.00057   24.5  -0.1   26  260-285     4-32  (40)
114 PF01485 IBR:  IBR domain;  Int  22.4      22 0.00047   25.0  -0.6   27  261-287    20-56  (64)
115 cd04707 otoconin_90 otoconin_9  21.8      21 0.00046   30.2  -0.9   20  193-212    17-46  (117)
116 KOG3777 Uncharacterized conser  21.8      62  0.0013   33.3   2.2   50  160-213   144-194 (443)
117 PF02891 zf-MIZ:  MIZ/SP-RING z  21.4      43 0.00093   24.0   0.7   24  259-282     2-26  (50)
118 PF13719 zinc_ribbon_5:  zinc-r  20.9      39 0.00085   22.7   0.4   11  259-269    25-35  (37)
119 cd00125 PLA2c PLA2c: Phospholi  20.5      16 0.00035   30.7  -1.9   20  192-211    19-48  (115)
120 PRK01103 formamidopyrimidine/5  20.0      32 0.00069   32.2  -0.2   26  261-286   247-272 (274)

No 1  
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=100.00  E-value=9.8e-64  Score=466.18  Aligned_cols=220  Identities=47%  Similarity=0.811  Sum_probs=179.7

Q ss_pred             eeecccCCCCCCCCceeecCCCccCC--------CCCCCCCCCCCceeeeccchhccc--cccccccccccccchhhhHH
Q 023002           46 VLQNLKKPTKPDSKLYFSTGPSKRDT--------SADSNADSEKPIFQFESSKEIQVQ--HDSKATATLETETDFLRDSR  115 (289)
Q Consensus        46 v~~~~kkr~k~~~~~~~st~~~~~~~--------~~~~~~~~~~~~~~~~ssr~~~~~--~d~~AT~~~e~dt~~d~Da~  115 (289)
                      +++..+.+++ ++|++|.+..+....        .+..+...+.+.|.|.|.+.+.+.  .++|||+++|.+|+..+|||
T Consensus        41 s~r~ek~~k~-~~p~~q~~k~~~k~~~~~~~~s~~s~~~~~~ed~vv~y~s~~~~~~~g~~dsgat~t~e~~te~~~Daq  119 (313)
T KOG1813|consen   41 SSRLEKLEKK-IKPETQRKKETDKVLTGEEDDSALSICQNPFEDPVVTYCSCDKCALKGHTDSGATATLEEPTEGLRDAQ  119 (313)
T ss_pred             hhhhhhhhhh-cchHhhhhhhhcccccccccccccccccCcccccceeeccccccccCCccccCceeEeecCcccchhHH
Confidence            3555555555 578877654322111        111223345799999998888765  59999999999999999999


Q ss_pred             HHHHHHHHhhHHHhcCCCCCCccccccccccccccccccccccccccCCCCCCCCCcCCceeeeeeeeeecCCCcCCCcc
Q 023002          116 ALREKVLKRSEEALKGKASGDEKLYKGIHGYVDHKAGFRREHTVSSEKAGGSHGPLRASAHIRVTARFDYQPDICKDYKE  195 (289)
Q Consensus       116 ai~er~~~~~~~~l~g~~~~~d~~YrG~~~y~~~~~~~~~~~~~~~~~~~~~~GPirap~niR~t~~~DyqPDiCKDyke  195 (289)
                      +|+|++++..++.+.|+  .++.+|+|+|+|.+|.+   ..++..++...|.+=|||||++||++++|||||||||||+|
T Consensus       120 a~~er~~k~~~e~~~~k--~~~~lykg~~~ya~~~k---~~~~~~~n~s~g~~rpira~~~~r~~~~~d~qpDicKdyke  194 (313)
T KOG1813|consen  120 AIIERRIKEEREKLRGK--KDTKLYKGINTYADDAK---AQKVVKMNESIGTVRPIRAAMHTRAGERIDYQPDICKDYKE  194 (313)
T ss_pred             HHhhhhHHHHHHhhcch--hHHHHHHHHHHHHhhhh---hhhhHhhhcccccccccchhhhhcccceeecCchhhhhhHh
Confidence            99999999778888886  48899999999999975   44445556666644499999999999999999999999999


Q ss_pred             cccccCCCceeeeeecccccccchhhHHHHHHHHHHhhhhcCCCCCCCCCCCCCCCCCCCCCCceeccccccccCCceec
Q 023002          196 TGYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEKARKRNLALGGGDSDEEGVGQSDDDDEDSLPFACFICRKPFVDPVVT  275 (289)
Q Consensus       196 TG~CGfGDsCKFlHdR~dyk~GWqld~ewe~~~k~kk~~l~~g~~~~~~~~~~~~~~~~e~~~p~~C~IC~~~f~dPVvT  275 (289)
                      ||||||||||||||+|+|||+||||++||++.+-.                 ......|++.+||.|.||++.|.+||||
T Consensus       195 Tgycg~gdSckFlh~r~DyK~GWqi~~e~d~~ke~-----------------~~~~~~D~~~~Pf~c~icr~~f~~pVvt  257 (313)
T KOG1813|consen  195 TGYCGYGDSCKFLHDRSDYKAGWQIEFEWDSAKEK-----------------KRVKIEDIELLPFKCFICRKYFYRPVVT  257 (313)
T ss_pred             hCcccccchhhhhhhhhhccccceeehhhhccccc-----------------cceecCCcccCCccccccccccccchhh
Confidence            99999999999999999999999999999977511                 1224456788999999999999999999


Q ss_pred             CCCChhhHHhHhc
Q 023002          276 KCKHYFCEHCALK  288 (289)
Q Consensus       276 ~CGH~FC~~Ci~~  288 (289)
                      .||||||+.|+++
T Consensus       258 ~c~h~fc~~ca~~  270 (313)
T KOG1813|consen  258 KCGHYFCEVCALK  270 (313)
T ss_pred             cCCceeehhhhcc
Confidence            9999999999975


No 2  
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=100.00  E-value=1.8e-42  Score=311.15  Aligned_cols=99  Identities=48%  Similarity=1.076  Sum_probs=86.9

Q ss_pred             CCceeeeeeeeeecCCCcCCCcccccccCCCceeeeeecccccccchhhHHHHHHHHHHhhhhcCCCCCCCCCCCCCCCC
Q 023002          173 ASAHIRVTARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEKARKRNLALGGGDSDEEGVGQSDD  252 (289)
Q Consensus       173 ap~niR~t~~~DyqPDiCKDykeTG~CGfGDsCKFlHdR~dyk~GWqld~ewe~~~k~kk~~l~~g~~~~~~~~~~~~~~  252 (289)
                      .|++||++++|||||||||||++||||||||||||||+|+|||.||||++||...-.       .+.          -..
T Consensus       127 ~Pt~~r~~~viD~qpdVCKdyk~TGYCGYGDsCKflH~R~D~KtGWkLn~EWnA~~E-------e~~----------v~~  189 (259)
T COG5152         127 QPTMFRDGEVIDTQPDVCKDYKETGYCGYGDSCKFLHDRSDFKTGWKLNQEWNAEYE-------EAP----------VIS  189 (259)
T ss_pred             CCceeeccceeecCcccccchhhcccccCCchhhhhhhhhhhhcccccchhhcchhh-------hcc----------ccc
Confidence            369999999999999999999999999999999999999999999999999983310       111          123


Q ss_pred             CCCCCCceeccccccccCCceecCCCChhhHHhHhc
Q 023002          253 DDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALK  288 (289)
Q Consensus       253 ~~e~~~p~~C~IC~~~f~dPVvT~CGH~FC~~Ci~~  288 (289)
                      .+-++|||.|.||.+.|..||||.|||+||+.|+++
T Consensus       190 ~~~e~IPF~C~iCKkdy~spvvt~CGH~FC~~Cai~  225 (259)
T COG5152         190 GPGEKIPFLCGICKKDYESPVVTECGHSFCSLCAIR  225 (259)
T ss_pred             CCCCCCceeehhchhhccchhhhhcchhHHHHHHHH
Confidence            445789999999999999999999999999999974


No 3  
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=98.86  E-value=7.8e-10  Score=76.74  Aligned_cols=27  Identities=44%  Similarity=0.995  Sum_probs=23.9

Q ss_pred             ccccccccCCceecCCCChhhHHhHhc
Q 023002          262 CFICRKPFVDPVVTKCKHYFCEHCALK  288 (289)
Q Consensus       262 C~IC~~~f~dPVvT~CGH~FC~~Ci~~  288 (289)
                      |+||++.|++||++.|||.||..||.+
T Consensus         1 CpiC~~~~~~Pv~l~CGH~FC~~Cl~~   27 (42)
T PF15227_consen    1 CPICLDLFKDPVSLPCGHSFCRSCLER   27 (42)
T ss_dssp             ETTTTSB-SSEEE-SSSSEEEHHHHHH
T ss_pred             CCccchhhCCccccCCcCHHHHHHHHH
Confidence            899999999999999999999999964


No 4  
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=98.67  E-value=1.4e-08  Score=93.60  Aligned_cols=33  Identities=45%  Similarity=0.811  Sum_probs=30.7

Q ss_pred             CCCceeccccccccCCceecCCCChhhHHhHhc
Q 023002          256 DSLPFACFICRKPFVDPVVTKCKHYFCEHCALK  288 (289)
Q Consensus       256 ~~~p~~C~IC~~~f~dPVvT~CGH~FC~~Ci~~  288 (289)
                      +.--|.|.||++.-++||||.|||.|||.||.+
T Consensus        44 ~~~~FdCNICLd~akdPVvTlCGHLFCWpClyq   76 (230)
T KOG0823|consen   44 DGGFFDCNICLDLAKDPVVTLCGHLFCWPCLYQ   76 (230)
T ss_pred             CCCceeeeeeccccCCCEEeecccceehHHHHH
Confidence            566899999999999999999999999999975


No 5  
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=98.58  E-value=1.7e-08  Score=68.08  Aligned_cols=27  Identities=52%  Similarity=1.081  Sum_probs=24.4

Q ss_pred             ccccccccCCc-eecCCCChhhHHhHhc
Q 023002          262 CFICRKPFVDP-VVTKCKHYFCEHCALK  288 (289)
Q Consensus       262 C~IC~~~f~dP-VvT~CGH~FC~~Ci~~  288 (289)
                      |+||.+.+.+| |++.|||.||..|+.+
T Consensus         1 C~iC~~~~~~~~~~~~CGH~fC~~C~~~   28 (39)
T PF13923_consen    1 CPICLDELRDPVVVTPCGHSFCKECIEK   28 (39)
T ss_dssp             ETTTTSB-SSEEEECTTSEEEEHHHHHH
T ss_pred             CCCCCCcccCcCEECCCCCchhHHHHHH
Confidence            89999999999 6899999999999974


No 6  
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=98.43  E-value=9.2e-08  Score=68.93  Aligned_cols=29  Identities=24%  Similarity=0.382  Sum_probs=27.5

Q ss_pred             eeccccccccCCceecCCCChhhHHhHhc
Q 023002          260 FACFICRKPFVDPVVTKCKHYFCEHCALK  288 (289)
Q Consensus       260 ~~C~IC~~~f~dPVvT~CGH~FC~~Ci~~  288 (289)
                      |.|+||++.+.+||+++|||.||..||.+
T Consensus         2 ~~Cpi~~~~~~~Pv~~~~G~v~~~~~i~~   30 (63)
T smart00504        2 FLCPISLEVMKDPVILPSGQTYERRAIEK   30 (63)
T ss_pred             cCCcCCCCcCCCCEECCCCCEEeHHHHHH
Confidence            68999999999999999999999999974


No 7  
>PF13445 zf-RING_UBOX:  RING-type zinc-finger; PDB: 2CT2_A.
Probab=98.38  E-value=9.7e-08  Score=67.11  Aligned_cols=26  Identities=46%  Similarity=1.166  Sum_probs=17.8

Q ss_pred             ccccccccCC----ceecCCCChhhHHhHhc
Q 023002          262 CFICRKPFVD----PVVTKCKHYFCEHCALK  288 (289)
Q Consensus       262 C~IC~~~f~d----PVvT~CGH~FC~~Ci~~  288 (289)
                      |+||++ |.+    |+++.|||.||+.|+.+
T Consensus         1 CpIc~e-~~~~~n~P~~L~CGH~~c~~cl~~   30 (43)
T PF13445_consen    1 CPICKE-FSTEENPPMVLPCGHVFCKDCLQK   30 (43)
T ss_dssp             -TTT-----TTSS-EEE-SSS-EEEHHHHHH
T ss_pred             CCcccc-ccCCCCCCEEEeCccHHHHHHHHH
Confidence            899999 988    99999999999999965


No 8  
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=98.37  E-value=1.6e-07  Score=84.02  Aligned_cols=32  Identities=38%  Similarity=0.812  Sum_probs=27.7

Q ss_pred             CCceecccccccc--CCceecCCCChhhHHhHhc
Q 023002          257 SLPFACFICRKPF--VDPVVTKCKHYFCEHCALK  288 (289)
Q Consensus       257 ~~p~~C~IC~~~f--~dPVvT~CGH~FC~~Ci~~  288 (289)
                      +.-|.||||+..+  +-||.|+|||.||..||..
T Consensus       129 ~~~~~CPiCl~~~sek~~vsTkCGHvFC~~Cik~  162 (187)
T KOG0320|consen  129 EGTYKCPICLDSVSEKVPVSTKCGHVFCSQCIKD  162 (187)
T ss_pred             ccccCCCceecchhhccccccccchhHHHHHHHH
Confidence            3459999999999  4688899999999999964


No 9  
>PF00097 zf-C3HC4:  Zinc finger, C3HC4 type (RING finger);  InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C3HC4 type zinc-finger (RING finger) is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C where X is any amino acid []. Many proteins containing a RING finger play a key role in the ubiquitination pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1CHC_A 2ECW_A 2Y43_B 1V87_A 2DJB_A 2H0D_B 3RPG_C 3KNV_A 2CKL_B 1JM7_A ....
Probab=98.27  E-value=2.8e-07  Score=61.87  Aligned_cols=27  Identities=52%  Similarity=1.179  Sum_probs=25.7

Q ss_pred             ccccccccCCce-ecCCCChhhHHhHhc
Q 023002          262 CFICRKPFVDPV-VTKCKHYFCEHCALK  288 (289)
Q Consensus       262 C~IC~~~f~dPV-vT~CGH~FC~~Ci~~  288 (289)
                      |+||++.+.+|+ ++.|||.||..|+.+
T Consensus         1 C~iC~~~~~~~~~~~~C~H~fC~~C~~~   28 (41)
T PF00097_consen    1 CPICLEPFEDPVILLPCGHSFCRDCLRK   28 (41)
T ss_dssp             ETTTSSBCSSEEEETTTSEEEEHHHHHH
T ss_pred             CCcCCccccCCCEEecCCCcchHHHHHH
Confidence            899999999999 999999999999974


No 10 
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones]
Probab=98.22  E-value=4.2e-07  Score=86.25  Aligned_cols=30  Identities=33%  Similarity=0.775  Sum_probs=28.1

Q ss_pred             ceeccccccccCCceecCCCChhhHHhHhc
Q 023002          259 PFACFICRKPFVDPVVTKCKHYFCEHCALK  288 (289)
Q Consensus       259 p~~C~IC~~~f~dPVvT~CGH~FC~~Ci~~  288 (289)
                      -++|.||++...||..|+|||.|||.||+.
T Consensus       239 ~~kC~LCLe~~~~pSaTpCGHiFCWsCI~~  268 (293)
T KOG0317|consen  239 TRKCSLCLENRSNPSATPCGHIFCWSCILE  268 (293)
T ss_pred             CCceEEEecCCCCCCcCcCcchHHHHHHHH
Confidence            478999999999999999999999999974


No 11 
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=98.12  E-value=8.6e-07  Score=89.38  Aligned_cols=30  Identities=43%  Similarity=0.928  Sum_probs=28.5

Q ss_pred             ceeccccccccCCceecCCCChhhHHhHhc
Q 023002          259 PFACFICRKPFVDPVVTKCKHYFCEHCALK  288 (289)
Q Consensus       259 p~~C~IC~~~f~dPVvT~CGH~FC~~Ci~~  288 (289)
                      +..||||+..+.-|+.|.|||.||..||++
T Consensus       186 ~~~CPICL~~~~~p~~t~CGHiFC~~CiLq  215 (513)
T KOG2164|consen  186 DMQCPICLEPPSVPVRTNCGHIFCGPCILQ  215 (513)
T ss_pred             CCcCCcccCCCCcccccccCceeeHHHHHH
Confidence            569999999999999999999999999985


No 12 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=98.08  E-value=1.8e-06  Score=59.79  Aligned_cols=28  Identities=43%  Similarity=0.988  Sum_probs=25.2

Q ss_pred             ecccccccc---CCceecCCCChhhHHhHhc
Q 023002          261 ACFICRKPF---VDPVVTKCKHYFCEHCALK  288 (289)
Q Consensus       261 ~C~IC~~~f---~dPVvT~CGH~FC~~Ci~~  288 (289)
                      .|+||.+.|   ..|++|.|||.||..|+.+
T Consensus         1 ~C~~C~~~~~~~~~~~l~~CgH~~C~~C~~~   31 (44)
T PF14634_consen    1 HCNICFEKYSEERRPRLTSCGHIFCEKCLKK   31 (44)
T ss_pred             CCcCcCccccCCCCeEEcccCCHHHHHHHHh
Confidence            389999999   5799999999999999975


No 13 
>smart00184 RING Ring finger. E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and is likely to be a general function of this domain; Various RING fingers exhibit binding activity towards E2 ubiquitin-conjugating enzymes (Ubc' s)
Probab=98.01  E-value=3.4e-06  Score=53.26  Aligned_cols=26  Identities=46%  Similarity=1.036  Sum_probs=24.9

Q ss_pred             ccccccccCCceecCCCChhhHHhHh
Q 023002          262 CFICRKPFVDPVVTKCKHYFCEHCAL  287 (289)
Q Consensus       262 C~IC~~~f~dPVvT~CGH~FC~~Ci~  287 (289)
                      |+||++...+|+++.|||.||..|+.
T Consensus         1 C~iC~~~~~~~~~~~C~H~~c~~C~~   26 (39)
T smart00184        1 CPICLEELKDPVVLPCGHTFCRSCIR   26 (39)
T ss_pred             CCcCccCCCCcEEecCCChHHHHHHH
Confidence            89999999999999999999999985


No 14 
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=97.96  E-value=2.8e-06  Score=79.93  Aligned_cols=30  Identities=37%  Similarity=0.880  Sum_probs=28.1

Q ss_pred             ceeccccccccCCceecCCCChhhHHhHhc
Q 023002          259 PFACFICRKPFVDPVVTKCKHYFCEHCALK  288 (289)
Q Consensus       259 p~~C~IC~~~f~dPVvT~CGH~FC~~Ci~~  288 (289)
                      -|.|+||.+...+|+.|.|||.||+.||+.
T Consensus       215 d~kC~lC~e~~~~ps~t~CgHlFC~~Cl~~  244 (271)
T COG5574         215 DYKCFLCLEEPEVPSCTPCGHLFCLSCLLI  244 (271)
T ss_pred             ccceeeeecccCCcccccccchhhHHHHHH
Confidence            367999999999999999999999999975


No 15 
>PF00642 zf-CCCH:  Zinc finger C-x8-C-x5-C-x3-H type (and similar);  InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents C-x8-C-x5-C-x3-H (CCCH) type Zinc finger (Znf) domains. Proteins containing CCCH Znf domains include Znf proteins from eukaryotes involved in cell cycle or growth phase-related regulation, e.g. human TIS11B (butyrate response factor 1), a probable regulatory protein involved in regulating the response to growth factors, and the mouse TTP growth factor-inducible nuclear protein, which has the same function. The mouse TTP protein is induced by growth factors. Another protein containing this domain is the human splicing factor U2AF 35kDa subunit, which plays a critical role in both constitutive and enhancer-dependent splicing by mediating essential protein-protein interactions and protein-RNA interactions required for 3' splice site selection. It has been shown that different CCCH-type Znf proteins interact with the 3'-untranslated region of various mRNA [, ]. This type of Znf is very often present in two copies. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding; PDB: 1M9O_A 1RGO_A 2CQE_A 2FC6_A 2D9M_A 2E5S_A 2RHK_C 2D9N_A 3D2S_A 3D2Q_C ....
Probab=97.96  E-value=7.2e-07  Score=56.65  Aligned_cols=27  Identities=37%  Similarity=1.074  Sum_probs=21.1

Q ss_pred             ecCCCcCCCcccccccCCCceeeeeec
Q 023002          185 YQPDICKDYKETGYCGYGDSCKFMHDR  211 (289)
Q Consensus       185 yqPDiCKDykeTG~CGfGDsCKFlHdR  211 (289)
                      |..-+|+.|.++|+|.||++|.|+|++
T Consensus         1 ~k~~~C~~f~~~g~C~~G~~C~f~H~~   27 (27)
T PF00642_consen    1 YKTKLCRFFMRTGTCPFGDKCRFAHGE   27 (27)
T ss_dssp             TTSSB-HHHHHTS--TTGGGSSSBSSG
T ss_pred             CccccChhhccCCccCCCCCcCccCCC
Confidence            345689999999999999999999985


No 16 
>smart00356 ZnF_C3H1 zinc finger.
Probab=97.96  E-value=3.4e-06  Score=51.93  Aligned_cols=26  Identities=50%  Similarity=1.261  Sum_probs=23.3

Q ss_pred             ecCCCcCCCcccccccCCCceeeeeec
Q 023002          185 YQPDICKDYKETGYCGYGDSCKFMHDR  211 (289)
Q Consensus       185 yqPDiCKDykeTG~CGfGDsCKFlHdR  211 (289)
                      |++-+|++| ++|+|.+|++|.|+|+.
T Consensus         2 ~k~~~C~~~-~~g~C~~g~~C~~~H~~   27 (27)
T smart00356        2 YKTELCKFF-KRGYCPYGDRCKFAHPL   27 (27)
T ss_pred             CCCCcCcCc-cCCCCCCCCCcCCCCcC
Confidence            567789999 99999999999999973


No 17 
>PF04564 U-box:  U-box domain;  InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis. Molecular chaperones recognise and contribute to the refolding of misfolded or unfolded proteins, whereas the ubiquitin-proteasome system mediates the degradation of such abnormal proteins. Ubiquitin-protein ligases (E3s) determine the substrate specificity for ubiquitylation and have been classified into HECT and RING-finger families. More recently, however, U-box proteins, which contain a domain (the U box) of about 70 amino acids that is conserved from yeast to humans, have been identified as a new type of E3 []. Members of the U-box family of proteins constitute a class of ubiquitin-protein ligases (E3s) distinct from the HECT-type and RING finger-containing E3 families []. Using yeast two-hybrid technology, all mammalian U-box proteins have been reported to interact with molecular chaperones or co-chaperones, including Hsp90, Hsp70, DnaJc7, EKN1, CRN, and VCP. This suggests that the function of U box-type E3s is to mediate the degradation of unfolded or misfolded proteins in conjunction with molecular chaperones as receptors that recognise such abnormal proteins [, ]. Unlike the RING finger domain, IPR001841 from INTERPRO, that is stabilised by Zn2+ ions coordinated by the cysteines and a histidine, the U-box scaffold is probably stabilised by a system of salt-bridges and hydrogen bonds. The charged and polar residues that participate in this network of bonds are more strongly conserved in the U-box proteins than in classic RING fingers, which supports their role in maintaining the stability of the U box. Thus, the U box appears to have evolved from a RING finger domain by appropriation of a new set of residues required to stabilise its structure, concomitant with the loss of the original, metal-chelating residues [].; GO: 0004842 ubiquitin-protein ligase activity, 0016567 protein ubiquitination, 0000151 ubiquitin ligase complex; PDB: 1T1H_A 2C2L_D 2C2V_V 1WGM_A 2KR4_A 3L1Z_B 3L1X_A 2KRE_A 3M63_A 2QIZ_A ....
Probab=97.84  E-value=5.7e-06  Score=62.97  Aligned_cols=30  Identities=23%  Similarity=0.400  Sum_probs=26.2

Q ss_pred             ceeccccccccCCceecCCCChhhHHhHhc
Q 023002          259 PFACFICRKPFVDPVVTKCKHYFCEHCALK  288 (289)
Q Consensus       259 p~~C~IC~~~f~dPVvT~CGH~FC~~Ci~~  288 (289)
                      .|.|+||.+.|+|||+++|||.|+..||.+
T Consensus         4 ~f~CpIt~~lM~dPVi~~~G~tyer~~I~~   33 (73)
T PF04564_consen    4 EFLCPITGELMRDPVILPSGHTYERSAIER   33 (73)
T ss_dssp             GGB-TTTSSB-SSEEEETTSEEEEHHHHHH
T ss_pred             ccCCcCcCcHhhCceeCCcCCEEcHHHHHH
Confidence            489999999999999999999999999974


No 18 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=97.84  E-value=6.2e-06  Score=58.10  Aligned_cols=29  Identities=41%  Similarity=0.799  Sum_probs=26.3

Q ss_pred             eeccccccccCCceecCCCCh-hhHHhHhc
Q 023002          260 FACFICRKPFVDPVVTKCKHY-FCEHCALK  288 (289)
Q Consensus       260 ~~C~IC~~~f~dPVvT~CGH~-FC~~Ci~~  288 (289)
                      +.|.||++.+.++++++|||. ||..|+.+
T Consensus         3 ~~C~iC~~~~~~~~~~pCgH~~~C~~C~~~   32 (50)
T PF13920_consen    3 EECPICFENPRDVVLLPCGHLCFCEECAER   32 (50)
T ss_dssp             SB-TTTSSSBSSEEEETTCEEEEEHHHHHH
T ss_pred             CCCccCCccCCceEEeCCCChHHHHHHhHH
Confidence            589999999999999999999 99999864


No 19 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=97.73  E-value=1.4e-05  Score=52.24  Aligned_cols=27  Identities=44%  Similarity=1.000  Sum_probs=24.2

Q ss_pred             eccccccccCCceecC-CCChhhHHhHh
Q 023002          261 ACFICRKPFVDPVVTK-CKHYFCEHCAL  287 (289)
Q Consensus       261 ~C~IC~~~f~dPVvT~-CGH~FC~~Ci~  287 (289)
                      .|+||++.+.+|+++. |||.||..|+.
T Consensus         1 ~C~iC~~~~~~~~~~~~C~H~~c~~C~~   28 (45)
T cd00162           1 ECPICLEEFREPVVLLPCGHVFCRSCID   28 (45)
T ss_pred             CCCcCchhhhCceEecCCCChhcHHHHH
Confidence            4999999998888776 99999999985


No 20 
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=97.64  E-value=1.6e-05  Score=54.44  Aligned_cols=28  Identities=32%  Similarity=0.670  Sum_probs=25.0

Q ss_pred             ecccccccc---CCceecCCCChhhHHhHhc
Q 023002          261 ACFICRKPF---VDPVVTKCKHYFCEHCALK  288 (289)
Q Consensus       261 ~C~IC~~~f---~dPVvT~CGH~FC~~Ci~~  288 (289)
                      .|+||++.|   ..++++.|||.||..||.+
T Consensus         2 ~C~IC~~~~~~~~~~~~l~C~H~fh~~Ci~~   32 (44)
T PF13639_consen    2 ECPICLEEFEDGEKVVKLPCGHVFHRSCIKE   32 (44)
T ss_dssp             CETTTTCBHHTTSCEEEETTSEEEEHHHHHH
T ss_pred             CCcCCChhhcCCCeEEEccCCCeeCHHHHHH
Confidence            599999999   4688899999999999864


No 21 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=97.56  E-value=2.1e-05  Score=60.28  Aligned_cols=28  Identities=36%  Similarity=0.938  Sum_probs=16.5

Q ss_pred             eeccccccccCCce-ecCCCChhhHHhHh
Q 023002          260 FACFICRKPFVDPV-VTKCKHYFCEHCAL  287 (289)
Q Consensus       260 ~~C~IC~~~f~dPV-vT~CGH~FC~~Ci~  287 (289)
                      +.|++|...++.|| ++.|.|.||+.||-
T Consensus         8 LrCs~C~~~l~~pv~l~~CeH~fCs~Ci~   36 (65)
T PF14835_consen    8 LRCSICFDILKEPVCLGGCEHIFCSSCIR   36 (65)
T ss_dssp             TS-SSS-S--SS-B---SSS--B-TTTGG
T ss_pred             cCCcHHHHHhcCCceeccCccHHHHHHhH
Confidence            57999999999998 59999999999985


No 22 
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]
Probab=97.45  E-value=3e-05  Score=81.17  Aligned_cols=30  Identities=40%  Similarity=0.957  Sum_probs=28.1

Q ss_pred             CceeccccccccCCceecCCCChhhHHhHh
Q 023002          258 LPFACFICRKPFVDPVVTKCKHYFCEHCAL  287 (289)
Q Consensus       258 ~p~~C~IC~~~f~dPVvT~CGH~FC~~Ci~  287 (289)
                      --+.|++|..-|+|-|+++|||.||..|+.
T Consensus       642 ~~LkCs~Cn~R~Kd~vI~kC~H~FC~~Cvq  671 (698)
T KOG0978|consen  642 ELLKCSVCNTRWKDAVITKCGHVFCEECVQ  671 (698)
T ss_pred             hceeCCCccCchhhHHHHhcchHHHHHHHH
Confidence            467899999999999999999999999985


No 23 
>PHA02929 N1R/p28-like protein; Provisional
Probab=97.42  E-value=6.9e-05  Score=69.64  Aligned_cols=30  Identities=30%  Similarity=0.754  Sum_probs=25.4

Q ss_pred             ceeccccccccCCc--------eecCCCChhhHHhHhc
Q 023002          259 PFACFICRKPFVDP--------VVTKCKHYFCEHCALK  288 (289)
Q Consensus       259 p~~C~IC~~~f~dP--------VvT~CGH~FC~~Ci~~  288 (289)
                      ...|+||++.+.++        |++.|||.||..||.+
T Consensus       174 ~~eC~ICle~~~~~~~~~~~~~vl~~C~H~FC~~CI~~  211 (238)
T PHA02929        174 DKECAICMEKVYDKEIKNMYFGILSNCNHVFCIECIDI  211 (238)
T ss_pred             CCCCccCCcccccCccccccceecCCCCCcccHHHHHH
Confidence            35899999998763        7889999999999963


No 24 
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=97.33  E-value=8.9e-05  Score=54.87  Aligned_cols=33  Identities=36%  Similarity=0.743  Sum_probs=24.0

Q ss_pred             CCCceeccccccccCCceec-CCCChhhHHhHhc
Q 023002          256 DSLPFACFICRKPFVDPVVT-KCKHYFCEHCALK  288 (289)
Q Consensus       256 ~~~p~~C~IC~~~f~dPVvT-~CGH~FC~~Ci~~  288 (289)
                      ..+.+.|||.+..|++||.. .|||.|....|++
T Consensus         8 ~~~~~~CPiT~~~~~~PV~s~~C~H~fek~aI~~   41 (57)
T PF11789_consen    8 GTISLKCPITLQPFEDPVKSKKCGHTFEKEAILQ   41 (57)
T ss_dssp             SB--SB-TTTSSB-SSEEEESSS--EEEHHHHHH
T ss_pred             cEeccCCCCcCChhhCCcCcCCCCCeecHHHHHH
Confidence            55789999999999999995 9999999998864


No 25 
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=97.19  E-value=0.00036  Score=67.60  Aligned_cols=75  Identities=20%  Similarity=0.449  Sum_probs=51.6

Q ss_pred             eeeeeecccccccchhhHHHHHHHHHHhhhhcCCCCCCCCCCCCCCCCCCCCCCceeccccccccCCceec-CCCChhhH
Q 023002          205 CKFMHDRGDYKSGWQMEKEWEEAEKARKRNLALGGGDSDEEGVGQSDDDDEDSLPFACFICRKPFVDPVVT-KCKHYFCE  283 (289)
Q Consensus       205 CKFlHdR~dyk~GWqld~ewe~~~k~kk~~l~~g~~~~~~~~~~~~~~~~e~~~p~~C~IC~~~f~dPVvT-~CGH~FC~  283 (289)
                      -..+.+-++|.---.--++||.=|..++.....|.      +- +  .---.+++++|+.|...+++|+-| -|||.||.
T Consensus       229 ~imit~EG~yVv~qpdvqsWe~Yq~r~~a~~~~~D------qv-~--k~~~~~i~LkCplc~~Llrnp~kT~cC~~~fc~  299 (427)
T COG5222         229 AIMITPEGGYVVAQPDVQSWEKYQQRTKAVAEIPD------QV-Y--KMQPPNISLKCPLCHCLLRNPMKTPCCGHTFCD  299 (427)
T ss_pred             ceEEcCCCCeEEeccchHHHHHHHHHHHhhhhCch------hh-h--ccCCCCccccCcchhhhhhCcccCccccchHHH
Confidence            34566677776655555889988765544222111      00 0  011257899999999999999999 78999999


Q ss_pred             HhHhc
Q 023002          284 HCALK  288 (289)
Q Consensus       284 ~Ci~~  288 (289)
                      .||..
T Consensus       300 eci~~  304 (427)
T COG5222         300 ECIGT  304 (427)
T ss_pred             HHHhh
Confidence            99963


No 26 
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=97.08  E-value=0.00016  Score=71.58  Aligned_cols=32  Identities=38%  Similarity=0.920  Sum_probs=29.7

Q ss_pred             CCceeccccccccCCceecCCCChhhHHhHhc
Q 023002          257 SLPFACFICRKPFVDPVVTKCKHYFCEHCALK  288 (289)
Q Consensus       257 ~~p~~C~IC~~~f~dPVvT~CGH~FC~~Ci~~  288 (289)
                      ..+|.|-||...|.+||+|+|||.||..||.+
T Consensus        82 ~sef~c~vc~~~l~~pv~tpcghs~c~~Cl~r  113 (398)
T KOG4159|consen   82 RSEFECCVCSRALYPPVVTPCGHSFCLECLDR  113 (398)
T ss_pred             cchhhhhhhHhhcCCCccccccccccHHHHHH
Confidence            45899999999999999999999999999764


No 27 
>PHA02926 zinc finger-like protein; Provisional
Probab=96.71  E-value=0.00071  Score=63.02  Aligned_cols=29  Identities=28%  Similarity=0.591  Sum_probs=24.4

Q ss_pred             eeccccccccC---------CceecCCCChhhHHhHhc
Q 023002          260 FACFICRKPFV---------DPVVTKCKHYFCEHCALK  288 (289)
Q Consensus       260 ~~C~IC~~~f~---------dPVvT~CGH~FC~~Ci~~  288 (289)
                      ..|+||++...         -+|+..|+|.||..||.+
T Consensus       171 ~eCgICmE~I~eK~~~~eRrFGIL~~CnHsFCl~CIr~  208 (242)
T PHA02926        171 KECGICYEVVYSKRLENDRYFGLLDSCNHIFCITCINI  208 (242)
T ss_pred             CCCccCccccccccccccccccccCCCCchHHHHHHHH
Confidence            48999998753         268999999999999963


No 28 
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=96.01  E-value=0.00073  Score=66.29  Aligned_cols=32  Identities=31%  Similarity=0.721  Sum_probs=28.8

Q ss_pred             CCceeccccccccCCceec-CCCChhhHHhHhc
Q 023002          257 SLPFACFICRKPFVDPVVT-KCKHYFCEHCALK  288 (289)
Q Consensus       257 ~~p~~C~IC~~~f~dPVvT-~CGH~FC~~Ci~~  288 (289)
                      .+.|.|+||+..++..++| .|+|-||..||..
T Consensus        41 ~~~v~c~icl~llk~tmttkeClhrfc~~ci~~   73 (381)
T KOG0311|consen   41 DIQVICPICLSLLKKTMTTKECLHRFCFDCIWK   73 (381)
T ss_pred             hhhhccHHHHHHHHhhcccHHHHHHHHHHHHHH
Confidence            5689999999999998877 7999999999975


No 29 
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=95.73  E-value=0.0047  Score=59.09  Aligned_cols=31  Identities=29%  Similarity=0.665  Sum_probs=27.7

Q ss_pred             CceeccccccccCCceecC-CCChhhHHhHhc
Q 023002          258 LPFACFICRKPFVDPVVTK-CKHYFCEHCALK  288 (289)
Q Consensus       258 ~p~~C~IC~~~f~dPVvT~-CGH~FC~~Ci~~  288 (289)
                      ....|++|.+.++.|.+.. |||.||..||..
T Consensus       238 ~~~~C~~Cg~~PtiP~~~~~C~HiyCY~Ci~t  269 (298)
T KOG2879|consen  238 SDTECPVCGEPPTIPHVIGKCGHIYCYYCIAT  269 (298)
T ss_pred             CCceeeccCCCCCCCeeeccccceeehhhhhh
Confidence            3568999999999999987 999999999864


No 30 
>PF12678 zf-rbx1:  RING-H2 zinc finger;  InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This domain constitutes a conserved region found in proteins that participate in diverse functions relevant to chromosome metabolism and cell cycle control [].The domain contains 8 cysteine/ histidine residues which are proposed to be the conserved residues involved in zinc binding.; PDB: 4A0C_D 4A0L_I 4A0K_B 2ECL_A 1LDK_C 3RTR_F 3DQV_Y 1U6G_B 1LDJ_B 2HYE_D ....
Probab=95.23  E-value=0.0086  Score=45.81  Aligned_cols=28  Identities=46%  Similarity=0.987  Sum_probs=22.8

Q ss_pred             eccccccccCCc-------------eecCCCChhhHHhHhc
Q 023002          261 ACFICRKPFVDP-------------VVTKCKHYFCEHCALK  288 (289)
Q Consensus       261 ~C~IC~~~f~dP-------------VvT~CGH~FC~~Ci~~  288 (289)
                      .|.||++.|.+|             ++..|||.|-..||.+
T Consensus        21 ~C~IC~~~l~~~~~~~~~~~~~~~i~~~~C~H~FH~~Ci~~   61 (73)
T PF12678_consen   21 NCAICREPLEDPCPECQAPQDECPIVWGPCGHIFHFHCISQ   61 (73)
T ss_dssp             BETTTTSBTTSTTCCHHHCTTTS-EEEETTSEEEEHHHHHH
T ss_pred             cccccChhhhChhhhhcCCccccceEecccCCCEEHHHHHH
Confidence            399999999443             4568999999999963


No 31 
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only]
Probab=95.04  E-value=0.011  Score=55.54  Aligned_cols=33  Identities=30%  Similarity=0.899  Sum_probs=28.1

Q ss_pred             eeeeeecCCCcCCCcccccccCCCceeeeeecc
Q 023002          180 TARFDYQPDICKDYKETGYCGYGDSCKFMHDRG  212 (289)
Q Consensus       180 t~~~DyqPDiCKDykeTG~CGfGDsCKFlHdR~  212 (289)
                      ....-|.=.+|..|..||+|-||..|+|.|...
T Consensus       170 ~~~~~~kt~lC~~f~~tG~C~yG~rC~F~H~~~  202 (332)
T KOG1677|consen  170 GNPPKYKTKLCPKFQKTGLCKYGSRCRFIHGEP  202 (332)
T ss_pred             cCCCCCCCcCCCccccCCCCCCCCcCeecCCCc
Confidence            334557778999999999999999999999854


No 32 
>KOG3039 consensus Uncharacterized conserved protein [Function unknown]
Probab=95.01  E-value=0.0095  Score=56.56  Aligned_cols=30  Identities=33%  Similarity=0.599  Sum_probs=27.7

Q ss_pred             ce-eccccccccCCceecCCCChhhHHhHhc
Q 023002          259 PF-ACFICRKPFVDPVVTKCKHYFCEHCALK  288 (289)
Q Consensus       259 p~-~C~IC~~~f~dPVvT~CGH~FC~~Ci~~  288 (289)
                      || .|.+|++++.|||+++=||.||..|||+
T Consensus        42 ~FdcCsLtLqPc~dPvit~~GylfdrEaILe   72 (303)
T KOG3039|consen   42 PFDCCSLTLQPCRDPVITPDGYLFDREAILE   72 (303)
T ss_pred             CcceeeeecccccCCccCCCCeeeeHHHHHH
Confidence            45 5899999999999999999999999985


No 33 
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]
Probab=94.67  E-value=0.016  Score=60.97  Aligned_cols=29  Identities=34%  Similarity=0.766  Sum_probs=27.2

Q ss_pred             eeccccccccCCceecCCCChhhHHhHhcC
Q 023002          260 FACFICRKPFVDPVVTKCKHYFCEHCALKV  289 (289)
Q Consensus       260 ~~C~IC~~~f~dPVvT~CGH~FC~~Ci~~v  289 (289)
                      +.|+||.+ ...+|+|.|||.||..|+..+
T Consensus       455 ~~c~ic~~-~~~~~it~c~h~~c~~c~~~~  483 (674)
T KOG1001|consen  455 HWCHICCD-LDSFFITRCGHDFCVECLKKS  483 (674)
T ss_pred             cccccccc-cccceeecccchHHHHHHHhc
Confidence            89999999 999999999999999999753


No 34 
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]
Probab=94.41  E-value=0.015  Score=60.27  Aligned_cols=33  Identities=30%  Similarity=0.729  Sum_probs=29.1

Q ss_pred             CCCCceeccccccccCCceecCCCChhhHHhHh
Q 023002          255 EDSLPFACFICRKPFVDPVVTKCKHYFCEHCAL  287 (289)
Q Consensus       255 e~~~p~~C~IC~~~f~dPVvT~CGH~FC~~Ci~  287 (289)
                      +..-...|.+|.++-.+||++.|.|.||..|+-
T Consensus       532 enk~~~~C~lc~d~aed~i~s~ChH~FCrlCi~  564 (791)
T KOG1002|consen  532 ENKGEVECGLCHDPAEDYIESSCHHKFCRLCIK  564 (791)
T ss_pred             cccCceeecccCChhhhhHhhhhhHHHHHHHHH
Confidence            344467899999999999999999999999983


No 35 
>KOG0825 consensus PHD Zn-finger protein [General function prediction only]
Probab=92.22  E-value=0.029  Score=60.26  Aligned_cols=30  Identities=33%  Similarity=0.654  Sum_probs=25.4

Q ss_pred             ceeccccccccCCcee---cCCCChhhHHhHhc
Q 023002          259 PFACFICRKPFVDPVV---TKCKHYFCEHCALK  288 (289)
Q Consensus       259 p~~C~IC~~~f~dPVv---T~CGH~FC~~Ci~~  288 (289)
                      .-.|++|+..|.+-++   .+|+||||..||..
T Consensus       123 ~~~CP~Ci~s~~DqL~~~~k~c~H~FC~~Ci~s  155 (1134)
T KOG0825|consen  123 ENQCPNCLKSCNDQLEESEKHTAHYFCEECVGS  155 (1134)
T ss_pred             hhhhhHHHHHHHHHhhccccccccccHHHHhhh
Confidence            4579999999988665   58999999999863


No 36 
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=91.85  E-value=0.068  Score=54.50  Aligned_cols=29  Identities=28%  Similarity=0.644  Sum_probs=26.6

Q ss_pred             eeccccccccCC-----ceecCCCChhhHHhHhc
Q 023002          260 FACFICRKPFVD-----PVVTKCKHYFCEHCALK  288 (289)
Q Consensus       260 ~~C~IC~~~f~d-----PVvT~CGH~FC~~Ci~~  288 (289)
                      -.|+||++.+..     |-..+|||.||..|+.+
T Consensus       292 ~~C~IC~e~l~~~~~~~~~rL~C~Hifh~~CL~~  325 (543)
T KOG0802|consen  292 ELCIICLEELHSGHNITPKRLPCGHIFHDSCLRS  325 (543)
T ss_pred             CeeeeechhhccccccccceeecccchHHHHHHH
Confidence            489999999998     89999999999999864


No 37 
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=90.27  E-value=0.13  Score=51.29  Aligned_cols=28  Identities=29%  Similarity=0.653  Sum_probs=26.7

Q ss_pred             eccccccccCCceecCCCChhhHHhHhc
Q 023002          261 ACFICRKPFVDPVVTKCKHYFCEHCALK  288 (289)
Q Consensus       261 ~C~IC~~~f~dPVvT~CGH~FC~~Ci~~  288 (289)
                      .|+||--.+.+.|.++|+|--|..||.+
T Consensus       424 lCpICyA~pi~Avf~PC~H~SC~~CI~q  451 (489)
T KOG4692|consen  424 LCPICYAGPINAVFAPCSHRSCYGCITQ  451 (489)
T ss_pred             cCcceecccchhhccCCCCchHHHHHHH
Confidence            8999999999999999999999999964


No 38 
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=89.59  E-value=0.14  Score=50.26  Aligned_cols=30  Identities=30%  Similarity=0.718  Sum_probs=26.1

Q ss_pred             ceeccccccccCCce-----e---cCCCChhhHHhHhc
Q 023002          259 PFACFICRKPFVDPV-----V---TKCKHYFCEHCALK  288 (289)
Q Consensus       259 p~~C~IC~~~f~dPV-----v---T~CGH~FC~~Ci~~  288 (289)
                      ...|-||++....++     .   -.|-|.||..||..
T Consensus       161 ~k~CGICme~i~ek~~~~~rfgilpnC~H~~Cl~Cir~  198 (344)
T KOG1039|consen  161 EKECGICMETINEKAASERRFGILPNCNHSFCLNCIRK  198 (344)
T ss_pred             cccceehhhhccccchhhhhcccCCCcchhhhhcHhHh
Confidence            578999999998887     3   78999999999853


No 39 
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=89.57  E-value=0.1  Score=39.51  Aligned_cols=28  Identities=39%  Similarity=0.901  Sum_probs=24.8

Q ss_pred             eccccccccCCceecCCCCh-hhHHhHhc
Q 023002          261 ACFICRKPFVDPVVTKCKHY-FCEHCALK  288 (289)
Q Consensus       261 ~C~IC~~~f~dPVvT~CGH~-FC~~Ci~~  288 (289)
                      .|.||.+.+.|.|+-.|||. .|..|.++
T Consensus         9 ECTICye~pvdsVlYtCGHMCmCy~Cg~r   37 (62)
T KOG4172|consen    9 ECTICYEHPVDSVLYTCGHMCMCYACGLR   37 (62)
T ss_pred             ceeeeccCcchHHHHHcchHHhHHHHHHH
Confidence            69999999999999999996 68888764


No 40 
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=89.03  E-value=0.18  Score=50.84  Aligned_cols=31  Identities=29%  Similarity=0.676  Sum_probs=26.2

Q ss_pred             CCceeccccccccCC---ceecCCCChhhHHhHh
Q 023002          257 SLPFACFICRKPFVD---PVVTKCKHYFCEHCAL  287 (289)
Q Consensus       257 ~~p~~C~IC~~~f~d---PVvT~CGH~FC~~Ci~  287 (289)
                      ..-|.|-||.+...-   =+.++|+|+||..|+.
T Consensus       182 ~slf~C~ICf~e~~G~~c~~~lpC~Hv~Ck~C~k  215 (445)
T KOG1814|consen  182 NSLFDCCICFEEQMGQHCFKFLPCSHVFCKSCLK  215 (445)
T ss_pred             hhcccceeeehhhcCcceeeecccchHHHHHHHH
Confidence            347899999999854   5679999999999974


No 41 
>PF14608 zf-CCCH_2:  Zinc finger C-x8-C-x5-C-x3-H type
Probab=88.65  E-value=0.24  Score=29.27  Aligned_cols=19  Identities=42%  Similarity=0.822  Sum_probs=14.5

Q ss_pred             CcCCCcccccccCCCceeeeee
Q 023002          189 ICKDYKETGYCGYGDSCKFMHD  210 (289)
Q Consensus       189 iCKDykeTG~CGfGDsCKFlHd  210 (289)
                      +||-+..   |.+|++|.|+|-
T Consensus         1 ~Ck~~~~---C~~~~~C~f~HP   19 (19)
T PF14608_consen    1 PCKFGPN---CTNGDNCPFSHP   19 (19)
T ss_pred             CCcCcCC---CCCCCcCccCCc
Confidence            3674443   999999999993


No 42 
>PF04641 Rtf2:  Rtf2 RING-finger
Probab=88.39  E-value=0.33  Score=45.15  Aligned_cols=35  Identities=20%  Similarity=0.365  Sum_probs=27.6

Q ss_pred             CCCCceeccccccccCC--c--eecCCCChhhHHhHhcC
Q 023002          255 EDSLPFACFICRKPFVD--P--VVTKCKHYFCEHCALKV  289 (289)
Q Consensus       255 e~~~p~~C~IC~~~f~d--P--VvT~CGH~FC~~Ci~~v  289 (289)
                      ....+|.|||+...|..  +  .+-+|||.|++.++.++
T Consensus       109 ~~~~~~~CPvt~~~~~~~~~fv~l~~cG~V~s~~alke~  147 (260)
T PF04641_consen  109 NSEGRFICPVTGKEFNGKHKFVYLRPCGCVFSEKALKEL  147 (260)
T ss_pred             cCCceeECCCCCcccCCceeEEEEcCCCCEeeHHHHHhh
Confidence            34579999999999943  2  34699999999998654


No 43 
>KOG3039 consensus Uncharacterized conserved protein [Function unknown]
Probab=88.26  E-value=0.23  Score=47.49  Aligned_cols=31  Identities=19%  Similarity=0.462  Sum_probs=27.5

Q ss_pred             CceeccccccccCC----ceecCCCChhhHHhHhc
Q 023002          258 LPFACFICRKPFVD----PVVTKCKHYFCEHCALK  288 (289)
Q Consensus       258 ~p~~C~IC~~~f~d----PVvT~CGH~FC~~Ci~~  288 (289)
                      ..|.||||+..+.|    .|+-+|||.||..|+.+
T Consensus       220 ~ryiCpvtrd~LtNt~~ca~Lr~sg~Vv~~ecvEk  254 (303)
T KOG3039|consen  220 KRYICPVTRDTLTNTTPCAVLRPSGHVVTKECVEK  254 (303)
T ss_pred             cceecccchhhhcCccceEEeccCCcEeeHHHHHH
Confidence            57999999999988    46789999999999865


No 44 
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=86.86  E-value=0.57  Score=46.12  Aligned_cols=15  Identities=20%  Similarity=0.587  Sum_probs=9.7

Q ss_pred             cccccCCCceeeeee
Q 023002          196 TGYCGYGDSCKFMHD  210 (289)
Q Consensus       196 TG~CGfGDsCKFlHd  210 (289)
                      -|-|-||.+|.++|.
T Consensus       101 ~~~~~~g~~~~~~~~  115 (344)
T KOG1039|consen  101 HGQCRFGNGDVTLNG  115 (344)
T ss_pred             ccccccCCccccccc
Confidence            466666677776663


No 45 
>PF12861 zf-Apc11:  Anaphase-promoting complex subunit 11 RING-H2 finger
Probab=85.53  E-value=0.48  Score=38.21  Aligned_cols=16  Identities=56%  Similarity=0.972  Sum_probs=13.7

Q ss_pred             eecCCCChhhHHhHhc
Q 023002          273 VVTKCKHYFCEHCALK  288 (289)
Q Consensus       273 VvT~CGH~FC~~Ci~~  288 (289)
                      |.-.|+|.|=..||++
T Consensus        48 v~g~C~H~FH~hCI~k   63 (85)
T PF12861_consen   48 VWGKCSHNFHMHCILK   63 (85)
T ss_pred             eeccCccHHHHHHHHH
Confidence            5569999999999975


No 46 
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones]
Probab=83.24  E-value=0.5  Score=46.56  Aligned_cols=32  Identities=25%  Similarity=0.479  Sum_probs=26.5

Q ss_pred             CCceeccccccccCCceecCC-CChhhHHhHhc
Q 023002          257 SLPFACFICRKPFVDPVVTKC-KHYFCEHCALK  288 (289)
Q Consensus       257 ~~p~~C~IC~~~f~dPVvT~C-GH~FC~~Ci~~  288 (289)
                      ...-.||||++.-.||.+..= |-.||..|+.+
T Consensus       298 ~~~~~CpvClk~r~Nptvl~vSGyVfCY~Ci~~  330 (357)
T KOG0826|consen  298 PDREVCPVCLKKRQNPTVLEVSGYVFCYPCIFS  330 (357)
T ss_pred             CccccChhHHhccCCCceEEecceEEeHHHHHH
Confidence            344579999999999977655 99999999964


No 47 
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only]
Probab=82.56  E-value=0.45  Score=44.83  Aligned_cols=29  Identities=31%  Similarity=1.095  Sum_probs=24.0

Q ss_pred             ecCCCcCCCcccccccC-CCceeeeeeccc
Q 023002          185 YQPDICKDYKETGYCGY-GDSCKFMHDRGD  213 (289)
Q Consensus       185 yqPDiCKDykeTG~CGf-GDsCKFlHdR~d  213 (289)
                      |.=..|..|.++|+|.| |++|+|-|-..-
T Consensus       130 ~kt~lc~~~~~~g~c~y~ge~crfah~~~e  159 (332)
T KOG1677|consen  130 YKTPLCRSFRKSGTCKYRGEQCRFAHGLEE  159 (332)
T ss_pred             ccCCcceeeecCccccccCchhhhcCCccc
Confidence            44467999999999999 999999775544


No 48 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=81.54  E-value=0.6  Score=36.30  Aligned_cols=27  Identities=33%  Similarity=0.714  Sum_probs=23.3

Q ss_pred             eccccccccCCce--ecCCCChhhHHhHh
Q 023002          261 ACFICRKPFVDPV--VTKCKHYFCEHCAL  287 (289)
Q Consensus       261 ~C~IC~~~f~dPV--vT~CGH~FC~~Ci~  287 (289)
                      .|++|.+.+-+++  +.+|||.|-..|+.
T Consensus        80 ~C~vC~k~l~~~~f~~~p~~~v~H~~C~~  108 (109)
T PF10367_consen   80 KCSVCGKPLGNSVFVVFPCGHVVHYSCIK  108 (109)
T ss_pred             CccCcCCcCCCceEEEeCCCeEEeccccc
Confidence            5999999998765  47999999999975


No 49 
>PF03194 LUC7:  LUC7 N_terminus;  InterPro: IPR004882 This family consists of several LUC7 protein homologues that are restricted to eukaryotes. LUC7 has been shown to be a U1 snRNA associated protein [] with a role in splice site recognition []. The entry contains human and mouse LUC7 like (LUC7L) proteins [] and human cisplatin resistance-associated overexpressed protein (CROP) []. 
Probab=81.27  E-value=0.33  Score=45.50  Aligned_cols=42  Identities=29%  Similarity=0.642  Sum_probs=30.1

Q ss_pred             CCCCCcCCceeeeeeeeeecCCCcCCCcccccccCC---------Cceeeeee
Q 023002          167 SHGPLRASAHIRVTARFDYQPDICKDYKETGYCGYG---------DSCKFMHD  210 (289)
Q Consensus       167 ~~GPirap~niR~t~~~DyqPDiCKDykeTG~CGfG---------DsCKFlHd  210 (289)
                      +.|+-|...+-+.+..|+ -|||||.|-- |||++-         ..|..+|+
T Consensus        11 LMG~~Rn~~~~~~~~~f~-D~~VCk~~L~-g~CPhdLF~nTK~DLG~C~kiHd   61 (254)
T PF03194_consen   11 LMGSNRNGDPSKRKVHFT-DPDVCKYFLV-GFCPHDLFVNTKSDLGPCPKIHD   61 (254)
T ss_pred             HcCCccCCCccccCCCCC-CcccCHHHHh-CCCcHHHHhhcccccchhhhhcC
Confidence            346666554434446674 4999999986 999985         57999997


No 50 
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=79.08  E-value=0.88  Score=45.03  Aligned_cols=33  Identities=30%  Similarity=0.553  Sum_probs=24.2

Q ss_pred             CCCceeccccccccCCc----eecCCCChhhHHhHhc
Q 023002          256 DSLPFACFICRKPFVDP----VVTKCKHYFCEHCALK  288 (289)
Q Consensus       256 ~~~p~~C~IC~~~f~dP----VvT~CGH~FC~~Ci~~  288 (289)
                      ...+..|.||..-...+    .+..|+|.||..|+.+
T Consensus       143 ~~~~~~C~iC~~e~~~~~~~f~~~~C~H~fC~~C~k~  179 (384)
T KOG1812|consen  143 KLPKEECGICFVEDPEAEDMFSVLKCGHRFCKDCVKQ  179 (384)
T ss_pred             ccccccCccCccccccHhhhHHHhcccchhhhHHhHH
Confidence            34577899999333222    3789999999999864


No 51 
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=78.01  E-value=1.4  Score=44.07  Aligned_cols=31  Identities=26%  Similarity=0.540  Sum_probs=27.1

Q ss_pred             CCceeccccccccCC-ceecCCCChhhHHhHh
Q 023002          257 SLPFACFICRKPFVD-PVVTKCKHYFCEHCAL  287 (289)
Q Consensus       257 ~~p~~C~IC~~~f~d-PVvT~CGH~FC~~Ci~  287 (289)
                      .....|.||...+.. .+...|||.||..|..
T Consensus        68 ~~~~~c~ic~~~~~~~~~~~~c~H~~c~~cw~   99 (444)
T KOG1815|consen   68 KGDVQCGICVESYDGEIIGLGCGHPFCPPCWT   99 (444)
T ss_pred             CccccCCcccCCCcchhhhcCCCcHHHHHHHH
Confidence            456899999999996 7778999999999975


No 52 
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=77.95  E-value=0.83  Score=34.25  Aligned_cols=27  Identities=26%  Similarity=0.653  Sum_probs=24.4

Q ss_pred             eeccccccccCCceecCCCChhhHHhH
Q 023002          260 FACFICRKPFVDPVVTKCKHYFCEHCA  286 (289)
Q Consensus       260 ~~C~IC~~~f~dPVvT~CGH~FC~~Ci  286 (289)
                      ..|..|...-...++.+|||..|..|.
T Consensus         8 ~~~~~~~~~~~~~~~~pCgH~I~~~~f   34 (55)
T PF14447_consen    8 QPCVFCGFVGTKGTVLPCGHLICDNCF   34 (55)
T ss_pred             eeEEEccccccccccccccceeecccc
Confidence            468899999899999999999999886


No 53 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=77.89  E-value=1.4  Score=44.24  Aligned_cols=29  Identities=28%  Similarity=0.697  Sum_probs=27.1

Q ss_pred             eeccccccccCCceecCCCChhhHHhHhc
Q 023002          260 FACFICRKPFVDPVVTKCKHYFCEHCALK  288 (289)
Q Consensus       260 ~~C~IC~~~f~dPVvT~CGH~FC~~Ci~~  288 (289)
                      ..|.||-....=..+++|+|-.|-.|+++
T Consensus        62 ~~C~ICA~~~TYs~~~PC~H~~CH~Ca~R   90 (493)
T COG5236          62 MNCQICAGSTTYSARYPCGHQICHACAVR   90 (493)
T ss_pred             ceeEEecCCceEEEeccCCchHHHHHHHH
Confidence            48999999999999999999999999875


No 54 
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=76.16  E-value=1.7  Score=43.13  Aligned_cols=30  Identities=27%  Similarity=0.486  Sum_probs=26.8

Q ss_pred             CCCCCCceeccccccccCCceecCCCChhh
Q 023002          253 DDEDSLPFACFICRKPFVDPVVTKCKHYFC  282 (289)
Q Consensus       253 ~~e~~~p~~C~IC~~~f~dPVvT~CGH~FC  282 (289)
                      ..+...|-.|.||...+.+-+..+|||.-|
T Consensus       299 ~~~~~~p~lcVVcl~e~~~~~fvpcGh~cc  328 (355)
T KOG1571|consen  299 FRELPQPDLCVVCLDEPKSAVFVPCGHVCC  328 (355)
T ss_pred             ccccCCCCceEEecCCccceeeecCCcEEE
Confidence            345678999999999999999999999976


No 55 
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=75.02  E-value=2.4  Score=42.01  Aligned_cols=33  Identities=36%  Similarity=0.717  Sum_probs=28.6

Q ss_pred             CCCCceeccccccccCCceecCCCCh-hhHHhHh
Q 023002          255 EDSLPFACFICRKPFVDPVVTKCKHY-FCEHCAL  287 (289)
Q Consensus       255 e~~~p~~C~IC~~~f~dPVvT~CGH~-FC~~Ci~  287 (289)
                      +.+-.-.|-||+.-.+|-||++|-|. -|..|+.
T Consensus       286 ~~~~gkeCVIClse~rdt~vLPCRHLCLCs~Ca~  319 (349)
T KOG4265|consen  286 ESESGKECVICLSESRDTVVLPCRHLCLCSGCAK  319 (349)
T ss_pred             cccCCCeeEEEecCCcceEEecchhhehhHhHHH
Confidence            44557799999999999999999996 7888875


No 56 
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=73.72  E-value=1.8  Score=30.59  Aligned_cols=27  Identities=33%  Similarity=0.929  Sum_probs=21.5

Q ss_pred             eccccccccC----CceecCCCChhhHHhHh
Q 023002          261 ACFICRKPFV----DPVVTKCKHYFCEHCAL  287 (289)
Q Consensus       261 ~C~IC~~~f~----dPVvT~CGH~FC~~Ci~  287 (289)
                      .|.+|...|.    ..--..||+.||..|+.
T Consensus         4 ~C~~C~~~F~~~~rk~~Cr~Cg~~~C~~C~~   34 (57)
T cd00065           4 SCMGCGKPFTLTRRRHHCRNCGRIFCSKCSS   34 (57)
T ss_pred             cCcccCccccCCccccccCcCcCCcChHHcC
Confidence            6888988773    44557899999999975


No 57 
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=72.84  E-value=2.1  Score=42.38  Aligned_cols=30  Identities=23%  Similarity=0.510  Sum_probs=24.8

Q ss_pred             CceeccccccccCC---ceecCCCChhhHHhHh
Q 023002          258 LPFACFICRKPFVD---PVVTKCKHYFCEHCAL  287 (289)
Q Consensus       258 ~p~~C~IC~~~f~d---PVvT~CGH~FC~~Ci~  287 (289)
                      .++.|.||++.|..   -.+++|.|.|=-.||-
T Consensus       228 ~~~~CaIClEdY~~GdklRiLPC~H~FH~~CID  260 (348)
T KOG4628|consen  228 ATDTCAICLEDYEKGDKLRILPCSHKFHVNCID  260 (348)
T ss_pred             CCceEEEeecccccCCeeeEecCCCchhhccch
Confidence            34899999999963   5679999999888873


No 58 
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms]
Probab=72.67  E-value=1.6  Score=44.48  Aligned_cols=27  Identities=30%  Similarity=0.720  Sum_probs=25.5

Q ss_pred             eccccccccCCceecCCCChhhHHhHh
Q 023002          261 ACFICRKPFVDPVVTKCKHYFCEHCAL  287 (289)
Q Consensus       261 ~C~IC~~~f~dPVvT~CGH~FC~~Ci~  287 (289)
                      .|-||-+.=+|--+-+|||..|..|+.
T Consensus       371 LCKICaendKdvkIEPCGHLlCt~CLa  397 (563)
T KOG1785|consen  371 LCKICAENDKDVKIEPCGHLLCTSCLA  397 (563)
T ss_pred             HHHHhhccCCCcccccccchHHHHHHH
Confidence            599999999999999999999999984


No 59 
>KOG2333 consensus Uncharacterized conserved protein [General function prediction only]
Probab=71.38  E-value=1.1  Score=46.50  Aligned_cols=20  Identities=40%  Similarity=1.071  Sum_probs=17.7

Q ss_pred             ccccCCCceeeeeecccccc
Q 023002          197 GYCGYGDSCKFMHDRGDYKS  216 (289)
Q Consensus       197 G~CGfGDsCKFlHdR~dyk~  216 (289)
                      --|.|||.|+|.||-+-|++
T Consensus        88 ~~C~f~d~Crf~HDi~ayLa  107 (614)
T KOG2333|consen   88 SKCSFGDNCRFVHDIEAYLA  107 (614)
T ss_pred             ccCcccccccccccHHHHHh
Confidence            37999999999999988865


No 60 
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair]
Probab=68.70  E-value=1.4  Score=49.84  Aligned_cols=31  Identities=29%  Similarity=0.523  Sum_probs=28.0

Q ss_pred             CCceeccccccccC-CceecCCCChhhHHhHh
Q 023002          257 SLPFACFICRKPFV-DPVVTKCKHYFCEHCAL  287 (289)
Q Consensus       257 ~~p~~C~IC~~~f~-dPVvT~CGH~FC~~Ci~  287 (289)
                      ..++.|.||++..+ -=.++.|||.+|-.|..
T Consensus      1151 ~~~~~c~ic~dil~~~~~I~~cgh~~c~~c~~ 1182 (1394)
T KOG0298|consen 1151 SGHFVCEICLDILRNQGGIAGCGHEPCCRCDE 1182 (1394)
T ss_pred             hcccchHHHHHHHHhcCCeeeechhHhhhHHH
Confidence            45889999999998 78899999999999975


No 61 
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=65.13  E-value=2.7  Score=41.49  Aligned_cols=32  Identities=31%  Similarity=0.579  Sum_probs=26.4

Q ss_pred             CCceeccccccccC---CceecCCCChhhHHhHhc
Q 023002          257 SLPFACFICRKPFV---DPVVTKCKHYFCEHCALK  288 (289)
Q Consensus       257 ~~p~~C~IC~~~f~---dPVvT~CGH~FC~~Ci~~  288 (289)
                      ..-..|.||+..|.   .-++++|.|.|=..|+.+
T Consensus       321 ~~GveCaICms~fiK~d~~~vlPC~H~FH~~Cv~k  355 (374)
T COG5540         321 DKGVECAICMSNFIKNDRLRVLPCDHRFHVGCVDK  355 (374)
T ss_pred             CCCceEEEEhhhhcccceEEEeccCceechhHHHH
Confidence            34578999999993   368899999999999853


No 62 
>KOG1763 consensus Uncharacterized conserved protein, contains CCCH-type Zn-finger [General function prediction only]
Probab=64.69  E-value=1.7  Score=42.49  Aligned_cols=29  Identities=41%  Similarity=0.851  Sum_probs=22.8

Q ss_pred             eeecCCCcCCCcccccccCCCceeeeeecc
Q 023002          183 FDYQPDICKDYKETGYCGYGDSCKFMHDRG  212 (289)
Q Consensus       183 ~DyqPDiCKDykeTG~CGfGDsCKFlHdR~  212 (289)
                      +|=.--+|--|++ |.|+=|+-|||+||-.
T Consensus        88 vDPKSvvCafFk~-g~C~KG~kCKFsHdl~  116 (343)
T KOG1763|consen   88 VDPKSVVCAFFKQ-GTCTKGDKCKFSHDLA  116 (343)
T ss_pred             CCchHHHHHHHhc-cCCCCCCcccccchHH
Confidence            4444457887887 9999999999999843


No 63 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=63.84  E-value=3.3  Score=25.68  Aligned_cols=14  Identities=36%  Similarity=0.940  Sum_probs=12.1

Q ss_pred             CceeccccccccCC
Q 023002          258 LPFACFICRKPFVD  271 (289)
Q Consensus       258 ~p~~C~IC~~~f~d  271 (289)
                      .||.|++|...|.+
T Consensus        13 k~~~C~~C~k~F~~   26 (26)
T PF13465_consen   13 KPYKCPYCGKSFSN   26 (26)
T ss_dssp             SSEEESSSSEEESS
T ss_pred             CCCCCCCCcCeeCc
Confidence            68999999998863


No 64 
>KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification]
Probab=62.14  E-value=2.9  Score=42.59  Aligned_cols=23  Identities=39%  Similarity=0.999  Sum_probs=19.7

Q ss_pred             CCcCCCcccccccCCCceeeeeec
Q 023002          188 DICKDYKETGYCGYGDSCKFMHDR  211 (289)
Q Consensus       188 DiCKDykeTG~CGfGDsCKFlHdR  211 (289)
                      -+|+-|-+ |-|.||.+|.|.|--
T Consensus       141 kpC~ffLe-g~CRF~enCRfSHG~  163 (486)
T KOG2185|consen  141 KPCKFFLE-GRCRFGENCRFSHGL  163 (486)
T ss_pred             ccchHhhc-cccccCcccccccCc
Confidence            35988887 899999999999954


No 65 
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]
Probab=59.02  E-value=4.4  Score=41.60  Aligned_cols=32  Identities=28%  Similarity=0.676  Sum_probs=25.4

Q ss_pred             CCCceeccccccccCCce----ecCCCChhhHHhHhc
Q 023002          256 DSLPFACFICRKPFVDPV----VTKCKHYFCEHCALK  288 (289)
Q Consensus       256 ~~~p~~C~IC~~~f~dPV----vT~CGH~FC~~Ci~~  288 (289)
                      -++| +||||++-+-..|    .+.|-|.|=-.|+.+
T Consensus       173 tELP-TCpVCLERMD~s~~gi~t~~c~Hsfh~~cl~~  208 (493)
T KOG0804|consen  173 TELP-TCPVCLERMDSSTTGILTILCNHSFHCSCLMK  208 (493)
T ss_pred             ccCC-CcchhHhhcCccccceeeeecccccchHHHhh
Confidence            3577 9999999996654    579999998888753


No 67 
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=58.80  E-value=2.1  Score=31.52  Aligned_cols=28  Identities=29%  Similarity=0.698  Sum_probs=14.6

Q ss_pred             eeccccccccCC----ceecCCCChhhHHhHh
Q 023002          260 FACFICRKPFVD----PVVTKCKHYFCEHCAL  287 (289)
Q Consensus       260 ~~C~IC~~~f~d----PVvT~CGH~FC~~Ci~  287 (289)
                      -.|.+|...|.-    -.=-.||+.||..|..
T Consensus        10 ~~C~~C~~~F~~~~rrhhCr~CG~~vC~~Cs~   41 (69)
T PF01363_consen   10 SNCMICGKKFSLFRRRHHCRNCGRVVCSSCSS   41 (69)
T ss_dssp             SB-TTT--B-BSSS-EEE-TTT--EEECCCS-
T ss_pred             CcCcCcCCcCCCceeeEccCCCCCEECCchhC
Confidence            389999999921    1125799999999864


No 68 
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=58.60  E-value=3.4  Score=40.50  Aligned_cols=27  Identities=33%  Similarity=0.710  Sum_probs=22.8

Q ss_pred             ceeccccccccCCceecCCCChh-hHHh
Q 023002          259 PFACFICRKPFVDPVVTKCKHYF-CEHC  285 (289)
Q Consensus       259 p~~C~IC~~~f~dPVvT~CGH~F-C~~C  285 (289)
                      ..+|.||++.++|=|.+.|||.. |-.|
T Consensus       300 ~~LC~ICmDaP~DCvfLeCGHmVtCt~C  327 (350)
T KOG4275|consen  300 RRLCAICMDAPRDCVFLECGHMVTCTKC  327 (350)
T ss_pred             HHHHHHHhcCCcceEEeecCcEEeehhh
Confidence            67999999999999999999963 4444


No 69 
>PF10235 Cript:  Microtubule-associated protein CRIPT;  InterPro: IPR019367  The CRIPT protein is a cytoskeletal protein involved in microtubule production. This C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners []. 
Probab=52.73  E-value=6.6  Score=32.09  Aligned_cols=23  Identities=35%  Similarity=0.915  Sum_probs=19.4

Q ss_pred             eccccccccCCceecCCCChhhHHhHhc
Q 023002          261 ACFICRKPFVDPVVTKCKHYFCEHCALK  288 (289)
Q Consensus       261 ~C~IC~~~f~dPVvT~CGH~FC~~Ci~~  288 (289)
                      .|.||......|     ||.||..|+.+
T Consensus        46 ~C~~CK~~v~q~-----g~~YCq~CAYk   68 (90)
T PF10235_consen   46 KCKICKTKVHQP-----GAKYCQTCAYK   68 (90)
T ss_pred             cccccccccccC-----CCccChhhhcc
Confidence            699999877665     89999999864


No 70 
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=52.41  E-value=1.2  Score=45.05  Aligned_cols=32  Identities=34%  Similarity=0.582  Sum_probs=25.1

Q ss_pred             CCCceeccccccccCC------ceecCCCChhhHHhHh
Q 023002          256 DSLPFACFICRKPFVD------PVVTKCKHYFCEHCAL  287 (289)
Q Consensus       256 ~~~p~~C~IC~~~f~d------PVvT~CGH~FC~~Ci~  287 (289)
                      +.-.-.||-|.-+...      =+-|.||||||+-|..
T Consensus       365 ~~N~krCP~C~v~IEr~eGCnKM~C~~c~~~fc~~c~~  402 (445)
T KOG1814|consen  365 ESNSKRCPKCKVVIERSEGCNKMHCTKCGTYFCWICAE  402 (445)
T ss_pred             HhcCCCCCcccceeecCCCccceeeccccccceeehhh
Confidence            3456689999988743      3569999999999975


No 71 
>KOG2979 consensus Protein involved in DNA repair [General function prediction only]
Probab=51.40  E-value=5.6  Score=38.08  Aligned_cols=32  Identities=28%  Similarity=0.574  Sum_probs=26.4

Q ss_pred             CCCceeccccccccCCcee-cCCCChhhHHhHh
Q 023002          256 DSLPFACFICRKPFVDPVV-TKCKHYFCEHCAL  287 (289)
Q Consensus       256 ~~~p~~C~IC~~~f~dPVv-T~CGH~FC~~Ci~  287 (289)
                      +.+.+.|||-..++.+||+ ++|||.|-..=+.
T Consensus       173 e~fs~rdPis~~~I~nPviSkkC~HvydrDsI~  205 (262)
T KOG2979|consen  173 EVFSNRDPISKKPIVNPVISKKCGHVYDRDSIM  205 (262)
T ss_pred             hhhcccCchhhhhhhchhhhcCcCcchhhhhHH
Confidence            3567899999999999998 6999999765443


No 72 
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones]
Probab=51.13  E-value=6.4  Score=39.03  Aligned_cols=28  Identities=36%  Similarity=0.717  Sum_probs=20.2

Q ss_pred             eeccccccccC-CceecCCCChhhHHhHh
Q 023002          260 FACFICRKPFV-DPVVTKCKHYFCEHCAL  287 (289)
Q Consensus       260 ~~C~IC~~~f~-dPVvT~CGH~FC~~Ci~  287 (289)
                      .-|--|..+.. -=-+..|.|.||..|+.
T Consensus        91 HfCd~Cd~PI~IYGRmIPCkHvFCl~CAr  119 (389)
T KOG2932|consen   91 HFCDRCDFPIAIYGRMIPCKHVFCLECAR  119 (389)
T ss_pred             EeecccCCcceeeecccccchhhhhhhhh
Confidence            45777766442 23358999999999986


No 73 
>KOG0796 consensus Spliceosome subunit [RNA processing and modification]
Probab=48.74  E-value=3.7  Score=40.31  Aligned_cols=41  Identities=34%  Similarity=0.758  Sum_probs=29.0

Q ss_pred             CCCCcCCceeeeeeeeeecCCCcCCCcccccccCC---------Cceeeeee
Q 023002          168 HGPLRASAHIRVTARFDYQPDICKDYKETGYCGYG---------DSCKFMHD  210 (289)
Q Consensus       168 ~GPirap~niR~t~~~DyqPDiCKDykeTG~CGfG---------DsCKFlHd  210 (289)
                      .||-|..--=|..+.||= ||||+.|-. |||++-         ..|--.|+
T Consensus        13 MGs~r~~~~~~~~v~~~D-~~VC~~fLv-g~CPHDlF~nTk~dlg~C~kvHd   62 (319)
T KOG0796|consen   13 MGSNRDGDETRQRVKFDD-PDVCKSFLV-GFCPHDLFQNTKMDLGPCPKVHD   62 (319)
T ss_pred             hCCCcCCCcccCCCCCCc-hhHHHHHHh-CCCcHHHhhhhhcccCcccchhh
Confidence            455554433233456776 999999987 999974         77888887


No 74 
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=45.54  E-value=8.7  Score=40.18  Aligned_cols=30  Identities=33%  Similarity=0.818  Sum_probs=22.6

Q ss_pred             ceecccccccc-----------------CCceecCCCChhhHHhHhc
Q 023002          259 PFACFICRKPF-----------------VDPVVTKCKHYFCEHCALK  288 (289)
Q Consensus       259 p~~C~IC~~~f-----------------~dPVvT~CGH~FC~~Ci~~  288 (289)
                      --.|.||+.+.                 +|=++|+|-|.|=..|+++
T Consensus       571 t~dC~ICMt~I~l~~~~s~~~~~~~~~~~nYm~tPC~HifH~~CL~~  617 (636)
T KOG0828|consen  571 TNDCVICMTPIDLRSTGSDCMVASMMVRRNYMLTPCHHIFHRQCLLQ  617 (636)
T ss_pred             cccceEeccccceeeccCcchhhhhhhhccccccchHHHHHHHHHHH
Confidence            34699998765                 2456789999999999864


No 75 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=45.39  E-value=7.6  Score=22.58  Aligned_cols=14  Identities=36%  Similarity=0.842  Sum_probs=11.8

Q ss_pred             eeccccccccCCce
Q 023002          260 FACFICRKPFVDPV  273 (289)
Q Consensus       260 ~~C~IC~~~f~dPV  273 (289)
                      |.|++|...|.++.
T Consensus         1 y~C~~C~~~f~~~~   14 (23)
T PF00096_consen    1 YKCPICGKSFSSKS   14 (23)
T ss_dssp             EEETTTTEEESSHH
T ss_pred             CCCCCCCCccCCHH
Confidence            68999999998764


No 76 
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=45.30  E-value=9.4  Score=37.91  Aligned_cols=29  Identities=24%  Similarity=0.557  Sum_probs=22.8

Q ss_pred             ceecccccccc-----CCceecCCCChhhHHhHh
Q 023002          259 PFACFICRKPF-----VDPVVTKCKHYFCEHCAL  287 (289)
Q Consensus       259 p~~C~IC~~~f-----~dPVvT~CGH~FC~~Ci~  287 (289)
                      -..|++|+-..     -+.++=.|||-||+.|..
T Consensus       306 wr~CpkC~~~ie~~~GCnhm~CrC~~~fcy~C~~  339 (384)
T KOG1812|consen  306 WRQCPKCKFMIELSEGCNHMTCRCGHQFCYMCGG  339 (384)
T ss_pred             cCcCcccceeeeecCCcceEEeeccccchhhcCc
Confidence            35699998776     367776799999999973


No 77 
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown]
Probab=43.93  E-value=9.2  Score=37.78  Aligned_cols=29  Identities=38%  Similarity=0.801  Sum_probs=24.4

Q ss_pred             eeccccccccCC-c--eecCCCChhhHHhHhc
Q 023002          260 FACFICRKPFVD-P--VVTKCKHYFCEHCALK  288 (289)
Q Consensus       260 ~~C~IC~~~f~d-P--VvT~CGH~FC~~Ci~~  288 (289)
                      -.|.||+.-|.+ |  ++|.|-|||=..|+.+
T Consensus       116 gqCvICLygfa~~~~ft~T~C~Hy~H~~ClaR  147 (368)
T KOG4445|consen  116 GQCVICLYGFASSPAFTVTACDHYMHFACLAR  147 (368)
T ss_pred             CceEEEEEeecCCCceeeehhHHHHHHHHHHH
Confidence            479999999965 3  6899999999999853


No 78 
>PHA03096 p28-like protein; Provisional
Probab=43.29  E-value=12  Score=35.91  Aligned_cols=28  Identities=25%  Similarity=0.414  Sum_probs=23.1

Q ss_pred             eeccccccccC--------CceecCCCChhhHHhHh
Q 023002          260 FACFICRKPFV--------DPVVTKCKHYFCEHCAL  287 (289)
Q Consensus       260 ~~C~IC~~~f~--------dPVvT~CGH~FC~~Ci~  287 (289)
                      ..|.||++.-.        .-++..|-|.||..|+.
T Consensus       179 k~c~ic~e~~~~k~~~~~~fgil~~c~h~fc~~ci~  214 (284)
T PHA03096        179 KICGICLENIKAKYIIKKYYGILSEIKHEFNIFCIK  214 (284)
T ss_pred             hhcccchhhhhhhccccccccccccCCcHHHHHHHH
Confidence            57999998763        35668999999999985


No 79 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=42.76  E-value=10  Score=22.85  Aligned_cols=13  Identities=46%  Similarity=1.004  Sum_probs=11.4

Q ss_pred             ceeccccccccCC
Q 023002          259 PFACFICRKPFVD  271 (289)
Q Consensus       259 p~~C~IC~~~f~d  271 (289)
                      ||.|.+|...|.+
T Consensus         1 ~~~C~~C~~~F~~   13 (27)
T PF13912_consen    1 PFECDECGKTFSS   13 (27)
T ss_dssp             SEEETTTTEEESS
T ss_pred             CCCCCccCCccCC
Confidence            6899999999965


No 80 
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=42.26  E-value=13  Score=37.56  Aligned_cols=31  Identities=19%  Similarity=0.413  Sum_probs=24.7

Q ss_pred             CCceeccccccccCC---ceecCCCChhhHHhHh
Q 023002          257 SLPFACFICRKPFVD---PVVTKCKHYFCEHCAL  287 (289)
Q Consensus       257 ~~p~~C~IC~~~f~d---PVvT~CGH~FC~~Ci~  287 (289)
                      ..-|.|||=++--.+   |+...|||..|..-+.
T Consensus       332 HSvF~CPVlKeqtsdeNPPm~L~CGHVISkdAln  365 (394)
T KOG2817|consen  332 HSVFICPVLKEQTSDENPPMMLICGHVISKDALN  365 (394)
T ss_pred             cceeecccchhhccCCCCCeeeeccceecHHHHH
Confidence            346899998887753   9999999999886553


No 81 
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=41.75  E-value=11  Score=36.73  Aligned_cols=27  Identities=30%  Similarity=0.682  Sum_probs=23.2

Q ss_pred             eccccccccCCce----------ecCCCChhhHHhHh
Q 023002          261 ACFICRKPFVDPV----------VTKCKHYFCEHCAL  287 (289)
Q Consensus       261 ~C~IC~~~f~dPV----------vT~CGH~FC~~Ci~  287 (289)
                      .|.||.+.+-..|          ...|+|.|=+.||.
T Consensus       226 vCaVCg~~~~~s~~eegvienty~LsCnHvFHEfCIr  262 (328)
T KOG1734|consen  226 VCAVCGQQIDVSVDEEGVIENTYKLSCNHVFHEFCIR  262 (328)
T ss_pred             hhHhhcchheeecchhhhhhhheeeecccchHHHhhh
Confidence            7999999986655          57999999999984


No 82 
>PF05883 Baculo_RING:  Baculovirus U-box/Ring-like domain;  InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length. The function of this family is unknown, but it appears to be related to the U-box and ring finger domain by profile-profile comparison.
Probab=40.99  E-value=13  Score=32.42  Aligned_cols=31  Identities=23%  Similarity=0.510  Sum_probs=23.9

Q ss_pred             CceeccccccccCC--ce-ecCCC------ChhhHHhHhc
Q 023002          258 LPFACFICRKPFVD--PV-VTKCK------HYFCEHCALK  288 (289)
Q Consensus       258 ~p~~C~IC~~~f~d--PV-vT~CG------H~FC~~Ci~~  288 (289)
                      ....|.||.+..-+  -| ...||      |.||..|+.+
T Consensus        25 ~~~EC~IC~~~I~~~~GvV~vt~~g~lnLEkmfc~~C~~r   64 (134)
T PF05883_consen   25 CTVECQICFDRIDNNDGVVYVTDGGTLNLEKMFCADCDKR   64 (134)
T ss_pred             cCeeehhhhhhhhcCCCEEEEecCCeehHHHHHHHHHHHH
Confidence            35789999999977  33 34565      8999999864


No 83 
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=40.69  E-value=9.8  Score=31.41  Aligned_cols=28  Identities=39%  Similarity=0.916  Sum_probs=19.7

Q ss_pred             eeccccccccC-----CceecCCCChhhHHhHh
Q 023002          260 FACFICRKPFV-----DPVVTKCKHYFCEHCAL  287 (289)
Q Consensus       260 ~~C~IC~~~f~-----dPVvT~CGH~FC~~Ci~  287 (289)
                      -.|.+|..+|.     .-+-..|+|.+|..|-.
T Consensus        55 ~~C~~C~~~fg~l~~~~~~C~~C~~~VC~~C~~   87 (118)
T PF02318_consen   55 RHCARCGKPFGFLFNRGRVCVDCKHRVCKKCGV   87 (118)
T ss_dssp             SB-TTTS-BCSCTSTTCEEETTTTEEEETTSEE
T ss_pred             cchhhhCCcccccCCCCCcCCcCCccccCccCC
Confidence            38999998873     23457899999999853


No 84 
>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=39.16  E-value=10  Score=37.18  Aligned_cols=32  Identities=31%  Similarity=0.820  Sum_probs=26.9

Q ss_pred             CCCceeccccccccCCceecCC----CChhhHHhHh
Q 023002          256 DSLPFACFICRKPFVDPVVTKC----KHYFCEHCAL  287 (289)
Q Consensus       256 ~~~p~~C~IC~~~f~dPVvT~C----GH~FC~~Ci~  287 (289)
                      ...|+.|.+|.+-+.|--.-.|    .|-||-.|-.
T Consensus       265 ~~apLcCTLC~ERLEDTHFVQCPSVp~HKFCFPCSR  300 (352)
T KOG3579|consen  265 PSAPLCCTLCHERLEDTHFVQCPSVPSHKFCFPCSR  300 (352)
T ss_pred             CCCceeehhhhhhhccCceeecCCCcccceecccCH
Confidence            4568999999999998777777    7999999954


No 85 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=39.12  E-value=11  Score=21.18  Aligned_cols=13  Identities=46%  Similarity=0.961  Sum_probs=8.8

Q ss_pred             eeccccccccCCc
Q 023002          260 FACFICRKPFVDP  272 (289)
Q Consensus       260 ~~C~IC~~~f~dP  272 (289)
                      |.|++|...|.+.
T Consensus         1 ~~C~~C~~~~~~~   13 (24)
T PF13894_consen    1 FQCPICGKSFRSK   13 (24)
T ss_dssp             EE-SSTS-EESSH
T ss_pred             CCCcCCCCcCCcH
Confidence            6899999888764


No 86 
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport]
Probab=38.13  E-value=13  Score=41.06  Aligned_cols=28  Identities=32%  Similarity=0.923  Sum_probs=22.9

Q ss_pred             ecccccccc-CCc-eecCCCChhhHHhHhc
Q 023002          261 ACFICRKPF-VDP-VVTKCKHYFCEHCALK  288 (289)
Q Consensus       261 ~C~IC~~~f-~dP-VvT~CGH~FC~~Ci~~  288 (289)
                      .|-+|..++ ..| ++-+|||.|=+.|+++
T Consensus       819 ~C~~C~~~ll~~pF~vf~CgH~FH~~Cl~~  848 (911)
T KOG2034|consen  819 SCDHCGRPLLIKPFYVFPCGHCFHRDCLIR  848 (911)
T ss_pred             chHHhcchhhcCcceeeeccchHHHHHHHH
Confidence            699999887 334 5679999999999975


No 87 
>KOG1940 consensus Zn-finger protein [General function prediction only]
Probab=37.65  E-value=12  Score=35.96  Aligned_cols=32  Identities=41%  Similarity=0.783  Sum_probs=24.4

Q ss_pred             CCCCceecccccccc----CCceecCCCChhhHHhH
Q 023002          255 EDSLPFACFICRKPF----VDPVVTKCKHYFCEHCA  286 (289)
Q Consensus       255 e~~~p~~C~IC~~~f----~dPVvT~CGH~FC~~Ci  286 (289)
                      |...++.||||.+.+    .+|.+.+|||+-=..|+
T Consensus       154 e~~~~~ncPic~e~l~~s~~~~~~~~CgH~~h~~cf  189 (276)
T KOG1940|consen  154 ERSSEFNCPICKEYLFLSFEDAGVLKCGHYMHSRCF  189 (276)
T ss_pred             hhcccCCCchhHHHhccccccCCccCcccchHHHHH
Confidence            345677799999866    68999999998644444


No 88 
>KOG3002 consensus Zn finger protein [General function prediction only]
Probab=37.56  E-value=17  Score=35.27  Aligned_cols=31  Identities=26%  Similarity=0.641  Sum_probs=24.9

Q ss_pred             CceeccccccccCCceec-CCCChhhHHhHhc
Q 023002          258 LPFACFICRKPFVDPVVT-KCKHYFCEHCALK  288 (289)
Q Consensus       258 ~p~~C~IC~~~f~dPVvT-~CGH~FC~~Ci~~  288 (289)
                      .-+.||||...+.-|+.- .=||.-|..|-.+
T Consensus        47 ~lleCPvC~~~l~~Pi~QC~nGHlaCssC~~~   78 (299)
T KOG3002|consen   47 DLLDCPVCFNPLSPPIFQCDNGHLACSSCRTK   78 (299)
T ss_pred             hhccCchhhccCcccceecCCCcEehhhhhhh
Confidence            357899999999988753 3399999999743


No 89 
>PF10764 Gin:  Inhibitor of sigma-G Gin;  InterPro: IPR019700  Gin allows sigma-F to delay late forespore transcription by preventing sigma-G to take over before the cell has reached a critical stage of development. Gin is also known as CsfB []. 
Probab=36.92  E-value=15  Score=26.30  Aligned_cols=26  Identities=23%  Similarity=0.652  Sum_probs=21.0

Q ss_pred             eccccccccCCceecCCCChhhHHhHh
Q 023002          261 ACFICRKPFVDPVVTKCKHYFCEHCAL  287 (289)
Q Consensus       261 ~C~IC~~~f~dPVvT~CGH~FC~~Ci~  287 (289)
                      .|.||.+...+ =+.-.|+..|..|-.
T Consensus         1 ~CiiC~~~~~~-GI~I~~~fIC~~CE~   26 (46)
T PF10764_consen    1 KCIICGKEKEE-GIHIYGKFICSDCEK   26 (46)
T ss_pred             CeEeCCCcCCC-CEEEECeEehHHHHH
Confidence            48999998887 556689999999954


No 90 
>KOG3476 consensus Microtubule-associated protein CRIPT [Cytoskeleton]
Probab=36.87  E-value=11  Score=31.03  Aligned_cols=24  Identities=33%  Similarity=0.849  Sum_probs=20.1

Q ss_pred             eeccccccccCCceecCCCChhhHHhHhc
Q 023002          260 FACFICRKPFVDPVVTKCKHYFCEHCALK  288 (289)
Q Consensus       260 ~~C~IC~~~f~dPVvT~CGH~FC~~Ci~~  288 (289)
                      -.|.||......|     |-++|..|+.+
T Consensus        55 ~kC~iCk~~vHQ~-----GshYC~tCAY~   78 (100)
T KOG3476|consen   55 AKCRICKQLVHQP-----GSHYCQTCAYK   78 (100)
T ss_pred             chhHHHHHHhcCC-----cchhHhHhhhh
Confidence            4699999998888     77889999864


No 91 
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=36.74  E-value=21  Score=26.29  Aligned_cols=12  Identities=50%  Similarity=1.231  Sum_probs=6.7

Q ss_pred             cCCCChhhHHhH
Q 023002          275 TKCKHYFCEHCA  286 (289)
Q Consensus       275 T~CGH~FC~~Ci  286 (289)
                      ..|+++||..|=
T Consensus        25 ~~C~~~FC~dCD   36 (51)
T PF07975_consen   25 PKCKNHFCIDCD   36 (51)
T ss_dssp             TTTT--B-HHHH
T ss_pred             CCCCCccccCcC
Confidence            467888998884


No 92 
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]
Probab=34.15  E-value=20  Score=36.48  Aligned_cols=27  Identities=30%  Similarity=0.682  Sum_probs=21.8

Q ss_pred             eccccccccC-------------CceecCCCChhhHHhHh
Q 023002          261 ACFICRKPFV-------------DPVVTKCKHYFCEHCAL  287 (289)
Q Consensus       261 ~C~IC~~~f~-------------dPVvT~CGH~FC~~Ci~  287 (289)
                      .|.||++.+.             .|--.+|||.|=-.|+.
T Consensus       289 ~C~ICmde~~h~~~~~~~~~~~~~pKrLpCGHilHl~CLk  328 (491)
T COG5243         289 TCTICMDEMFHPDHEPLPRGLDMTPKRLPCGHILHLHCLK  328 (491)
T ss_pred             eEEEecccccCCCCccCcccccCCcccccccceeeHHHHH
Confidence            8999999843             24678999999888873


No 93 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=32.95  E-value=25  Score=22.41  Aligned_cols=21  Identities=19%  Similarity=0.474  Sum_probs=11.8

Q ss_pred             eccccccccCCce--ecCCCChh
Q 023002          261 ACFICRKPFVDPV--VTKCKHYF  281 (289)
Q Consensus       261 ~C~IC~~~f~dPV--vT~CGH~F  281 (289)
                      .||-|......-.  --.|||.|
T Consensus         2 ~CP~C~~~V~~~~~~Cp~CG~~F   24 (26)
T PF10571_consen    2 TCPECGAEVPESAKFCPHCGYDF   24 (26)
T ss_pred             cCCCCcCCchhhcCcCCCCCCCC
Confidence            4666666552211  24588887


No 94 
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=32.69  E-value=25  Score=24.09  Aligned_cols=11  Identities=36%  Similarity=0.821  Sum_probs=6.4

Q ss_pred             ceecccccccc
Q 023002          259 PFACFICRKPF  269 (289)
Q Consensus       259 p~~C~IC~~~f  269 (289)
                      ||.|..|...|
T Consensus        12 ~f~C~~C~~~F   22 (39)
T smart00154       12 GFKCRHCGNLF   22 (39)
T ss_pred             CeECCccCCcc
Confidence            66666555555


No 95 
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=32.22  E-value=24  Score=39.16  Aligned_cols=28  Identities=25%  Similarity=0.752  Sum_probs=21.4

Q ss_pred             eeccccccccCC---ce------ecCCCChhhHHhHh
Q 023002          260 FACFICRKPFVD---PV------VTKCKHYFCEHCAL  287 (289)
Q Consensus       260 ~~C~IC~~~f~d---PV------vT~CGH~FC~~Ci~  287 (289)
                      -.|.+|...|..   ++      --.||+.||..|-.
T Consensus       461 dtC~~C~kkFfSlsK~L~~RKHHCRkCGrVFC~~CSS  497 (1374)
T PTZ00303        461 DSCPSCGRAFISLSRPLGTRAHHCRSCGIRLCVFCIT  497 (1374)
T ss_pred             CcccCcCCcccccccccccccccccCCccccCccccC
Confidence            479999999942   12      24699999999963


No 96 
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=31.26  E-value=14  Score=26.09  Aligned_cols=12  Identities=42%  Similarity=1.101  Sum_probs=10.3

Q ss_pred             CCCChhhHHhHh
Q 023002          276 KCKHYFCEHCAL  287 (289)
Q Consensus       276 ~CGH~FC~~Ci~  287 (289)
                      .|||.||..|..
T Consensus        45 ~C~~~fC~~C~~   56 (64)
T smart00647       45 KCGFSFCFRCKV   56 (64)
T ss_pred             CCCCeECCCCCC
Confidence            789999999864


No 97 
>KOG1040 consensus Polyadenylation factor I complex, subunit, Yth1 (CPSF subunit) [RNA processing and modification]
Probab=31.25  E-value=15  Score=36.03  Aligned_cols=41  Identities=32%  Similarity=0.750  Sum_probs=26.4

Q ss_pred             CCCCCcCCceeeeeeeeeecCCCcCCCcccccccCCCceeeeee
Q 023002          167 SHGPLRASAHIRVTARFDYQPDICKDYKETGYCGYGDSCKFMHD  210 (289)
Q Consensus       167 ~~GPirap~niR~t~~~DyqPDiCKDykeTG~CGfGDsCKFlHd  210 (289)
                      ..|||---.+++.. .-++ -.|||.|-. |-|--||.|=|||.
T Consensus        59 ~~~~~~~~~~~~~~-~~~~-~~vcK~~l~-glC~kgD~C~Flhe   99 (325)
T KOG1040|consen   59 ERGPICPKSHNDVS-DSRG-KVVCKHWLR-GLCKKGDQCEFLHE   99 (325)
T ss_pred             cCCCCCccccCCcc-ccCC-ceeehhhhh-hhhhccCcCcchhh
Confidence            34554443444321 1233 577998887 89999999999995


No 98 
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins. Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Class
Probab=31.21  E-value=36  Score=24.23  Aligned_cols=27  Identities=33%  Similarity=0.810  Sum_probs=21.0

Q ss_pred             ecccccc--ccCCceecCCC-----ChhhHHhHh
Q 023002          261 ACFICRK--PFVDPVVTKCK-----HYFCEHCAL  287 (289)
Q Consensus       261 ~C~IC~~--~f~dPVvT~CG-----H~FC~~Ci~  287 (289)
                      .|.||+.  ...+|++.+|.     |+|=..|+.
T Consensus         1 ~CrIC~~~~~~~~~l~~PC~C~G~~~~vH~~Cl~   34 (49)
T smart00744        1 ICRICHDEGDEGDPLVSPCRCKGSLKYVHQECLE   34 (49)
T ss_pred             CccCCCCCCCCCCeeEeccccCCchhHHHHHHHH
Confidence            4899997  55789999995     777777764


No 99 
>COG4647 AcxC Acetone carboxylase, gamma subunit [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=30.60  E-value=22  Score=31.48  Aligned_cols=22  Identities=27%  Similarity=0.614  Sum_probs=17.4

Q ss_pred             ccccccccCCceecCCCChhhH
Q 023002          262 CFICRKPFVDPVVTKCKHYFCE  283 (289)
Q Consensus       262 C~IC~~~f~dPVvT~CGH~FC~  283 (289)
                      =+||...-+.-+--.|||.||-
T Consensus        60 lfi~qs~~~rv~rcecghsf~d   81 (165)
T COG4647          60 LFICQSAQKRVIRCECGHSFGD   81 (165)
T ss_pred             EEEEecccccEEEEeccccccC
Confidence            3688888877566789999995


No 100
>KOG2494 consensus C3H1-type Zn-finger protein [Transcription]
Probab=30.07  E-value=10  Score=37.49  Aligned_cols=26  Identities=15%  Similarity=0.349  Sum_probs=16.5

Q ss_pred             CceeeeeecccccccchhhHHHHHHH
Q 023002          203 DSCKFMHDRGDYKSGWQMEKEWEEAE  228 (289)
Q Consensus       203 DsCKFlHdR~dyk~GWqld~ewe~~~  228 (289)
                      |+|||||-=.+.|-+..|..|..-..
T Consensus        85 ~nCkylHpp~hlkdql~ingrn~l~l  110 (331)
T KOG2494|consen   85 ENCKYLHPPQHLKDQLKINGRNNLIL  110 (331)
T ss_pred             ccceecCCChhhhhhhhhcccccHHH
Confidence            66888887777666666655544433


No 101
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]
Probab=28.37  E-value=32  Score=38.14  Aligned_cols=27  Identities=30%  Similarity=0.688  Sum_probs=25.0

Q ss_pred             eccccccccCCceec-CCCChhhHHhHh
Q 023002          261 ACFICRKPFVDPVVT-KCKHYFCEHCAL  287 (289)
Q Consensus       261 ~C~IC~~~f~dPVvT-~CGH~FC~~Ci~  287 (289)
                      +|..|...+-=|+|- .|||.|=+.|+.
T Consensus       842 kCs~C~~~LdlP~VhF~CgHsyHqhC~e  869 (933)
T KOG2114|consen  842 KCSACEGTLDLPFVHFLCGHSYHQHCLE  869 (933)
T ss_pred             eecccCCccccceeeeecccHHHHHhhc
Confidence            799999999999995 999999999985


No 102
>KOG1729 consensus FYVE finger containing protein [General function prediction only]
Probab=27.49  E-value=19  Score=34.81  Aligned_cols=29  Identities=17%  Similarity=0.539  Sum_probs=21.4

Q ss_pred             ceeccccccccCC-----ceecCCCChhhHHhHh
Q 023002          259 PFACFICRKPFVD-----PVVTKCKHYFCEHCAL  287 (289)
Q Consensus       259 p~~C~IC~~~f~d-----PVvT~CGH~FC~~Ci~  287 (289)
                      --.|.+|......     --.-.||++||..|-.
T Consensus       168 a~~C~~C~~~~Ftl~~RRHHCR~CG~ivC~~Cs~  201 (288)
T KOG1729|consen  168 ATECMVCGCTEFTLSERRHHCRNCGDIVCAPCSR  201 (288)
T ss_pred             ceecccCCCccccHHHHHHHHHhcchHhhhhhhc
Confidence            3479999994322     2357899999999954


No 103
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=27.44  E-value=10  Score=24.09  Aligned_cols=26  Identities=23%  Similarity=0.554  Sum_probs=17.9

Q ss_pred             eccccccccCCceecCCCChhhHHhH
Q 023002          261 ACFICRKPFVDPVVTKCKHYFCEHCA  286 (289)
Q Consensus       261 ~C~IC~~~f~dPVvT~CGH~FC~~Ci  286 (289)
                      .|+.|...+.+-.+-.-..+||..|.
T Consensus         3 ~C~rC~~~~~~~~~~~r~~~~C~rCq   28 (30)
T PF06827_consen    3 KCPRCWNYIEDIGINGRSTYLCPRCQ   28 (30)
T ss_dssp             B-TTT--BBEEEEETTEEEEE-TTTC
T ss_pred             cCccCCCcceEeEecCCCCeECcCCc
Confidence            68888888888888788888888885


No 104
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=27.32  E-value=29  Score=29.44  Aligned_cols=27  Identities=41%  Similarity=1.065  Sum_probs=21.1

Q ss_pred             eccccccccCCce--------------ecCCCChhhHHhHh
Q 023002          261 ACFICRKPFVDPV--------------VTKCKHYFCEHCAL  287 (289)
Q Consensus       261 ~C~IC~~~f~dPV--------------vT~CGH~FC~~Ci~  287 (289)
                      .|.-|+..|..+.              -..|.+.||..|-+
T Consensus        57 ~C~~C~~~f~~~~~~~~~~~~~~~~y~C~~C~~~FC~dCD~   97 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSPFDELKDSHRYVCAVCKNVFCVDCDV   97 (112)
T ss_pred             cccCcCCCCCCcccccccccccccceeCCCCCCccccccch
Confidence            5999999887652              47899999988843


No 105
>KOG0825 consensus PHD Zn-finger protein [General function prediction only]
Probab=27.20  E-value=50  Score=36.72  Aligned_cols=28  Identities=18%  Similarity=0.331  Sum_probs=19.8

Q ss_pred             eccccccccCCc-------eecCCCChhhHHhHhc
Q 023002          261 ACFICRKPFVDP-------VVTKCKHYFCEHCALK  288 (289)
Q Consensus       261 ~C~IC~~~f~dP-------VvT~CGH~FC~~Ci~~  288 (289)
                      .|.||..-|.+|       .+..|+|.||..||+.
T Consensus        98 Ss~~C~~E~S~~~ds~~i~P~~~~~~~~CP~Ci~s  132 (1134)
T KOG0825|consen   98 TSPVCEKEHSPDVDSSNICPVQTHVENQCPNCLKS  132 (1134)
T ss_pred             ccchhheecCCcccccCcCchhhhhhhhhhHHHHH
Confidence            466665555553       3467999999999974


No 106
>KOG1492 consensus C3H1-type Zn-finger protein [General function prediction only]
Probab=27.16  E-value=26  Score=33.67  Aligned_cols=31  Identities=32%  Similarity=0.750  Sum_probs=24.8

Q ss_pred             eeee--cCCCcCCCcccccccCCCceeeeeecc
Q 023002          182 RFDY--QPDICKDYKETGYCGYGDSCKFMHDRG  212 (289)
Q Consensus       182 ~~Dy--qPDiCKDykeTG~CGfGDsCKFlHdR~  212 (289)
                      .+.|  .--||-.|..-|||-.|-|||-.|+-.
T Consensus       281 hihysenapicfefakygfcelgtscknqhilq  313 (377)
T KOG1492|consen  281 HIHYSENAPICFEFAKYGFCELGTSCKNQHILQ  313 (377)
T ss_pred             EEeecCCCceeeeehhcceeccccccccceeee
Confidence            3444  245899999999999999999999753


No 107
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=26.45  E-value=24  Score=20.85  Aligned_cols=15  Identities=40%  Similarity=0.755  Sum_probs=12.1

Q ss_pred             eeccccccccCCcee
Q 023002          260 FACFICRKPFVDPVV  274 (289)
Q Consensus       260 ~~C~IC~~~f~dPVv  274 (289)
                      |.|.||...|.++..
T Consensus         1 ~~C~~C~~~f~s~~~   15 (25)
T PF12874_consen    1 FYCDICNKSFSSENS   15 (25)
T ss_dssp             EEETTTTEEESSHHH
T ss_pred             CCCCCCCCCcCCHHH
Confidence            679999999987643


No 108
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=25.78  E-value=36  Score=23.58  Aligned_cols=31  Identities=32%  Similarity=0.601  Sum_probs=24.7

Q ss_pred             CceeccccccccCCc-eecCCCChhhHHhHhc
Q 023002          258 LPFACFICRKPFVDP-VVTKCKHYFCEHCALK  288 (289)
Q Consensus       258 ~p~~C~IC~~~f~dP-VvT~CGH~FC~~Ci~~  288 (289)
                      .=|.|.+|...+.+. ....=|..+|..|..+
T Consensus        25 ~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~   56 (58)
T PF00412_consen   25 ECFKCSKCGKPLNDGDFYEKDGKPYCKDCYQK   56 (58)
T ss_dssp             TTSBETTTTCBTTTSSEEEETTEEEEHHHHHH
T ss_pred             cccccCCCCCccCCCeeEeECCEEECHHHHhh
Confidence            368999999999765 5666678999998754


No 109
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=24.05  E-value=29  Score=31.80  Aligned_cols=25  Identities=24%  Similarity=0.733  Sum_probs=22.4

Q ss_pred             ccccccccCCceecCCCCh-hhHHhH
Q 023002          262 CFICRKPFVDPVVTKCKHY-FCEHCA  286 (289)
Q Consensus       262 C~IC~~~f~dPVvT~CGH~-FC~~Ci  286 (289)
                      |.+|+..-..-++.+|-|+ +|..|-
T Consensus       161 Cr~C~~~~~~VlllPCrHl~lC~~C~  186 (207)
T KOG1100|consen  161 CRKCGEREATVLLLPCRHLCLCGICD  186 (207)
T ss_pred             ceecCcCCceEEeecccceEeccccc
Confidence            9999999999899999985 788886


No 110
>COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only]
Probab=23.72  E-value=38  Score=33.60  Aligned_cols=23  Identities=39%  Similarity=1.080  Sum_probs=20.1

Q ss_pred             CCcCCCcccccccCCCceeeeee
Q 023002          188 DICKDYKETGYCGYGDSCKFMHD  210 (289)
Q Consensus       188 DiCKDykeTG~CGfGDsCKFlHd  210 (289)
                      .-|+..-..|||+||--|-|-|-
T Consensus       275 ePcinwe~sGyc~yg~Rc~F~hg  297 (351)
T COG5063         275 EPCINWEKSGYCPYGLRCCFKHG  297 (351)
T ss_pred             CCccchhhcccCccccccccccC
Confidence            44889988999999999999883


No 111
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=23.44  E-value=39  Score=21.31  Aligned_cols=15  Identities=33%  Similarity=0.859  Sum_probs=12.7

Q ss_pred             ceeccccccccCCce
Q 023002          259 PFACFICRKPFVDPV  273 (289)
Q Consensus       259 p~~C~IC~~~f~dPV  273 (289)
                      +|.|.+|...|.++.
T Consensus         3 ~~~C~~C~~~~~~~~   17 (35)
T smart00451        3 GFYCKLCNVTFTDEI   17 (35)
T ss_pred             CeEccccCCccCCHH
Confidence            689999999998654


No 112
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=23.26  E-value=17  Score=28.49  Aligned_cols=13  Identities=54%  Similarity=1.546  Sum_probs=6.8

Q ss_pred             eecCCC--ChhhHHh
Q 023002          273 VVTKCK--HYFCEHC  285 (289)
Q Consensus       273 VvT~CG--H~FC~~C  285 (289)
                      |+-.||  -|||..|
T Consensus        42 ~LkACGAvdYFC~~c   56 (70)
T PF07191_consen   42 VLKACGAVDYFCNHC   56 (70)
T ss_dssp             EEEETTEEEEE-TTT
T ss_pred             HHHHhcccceeeccC
Confidence            445666  5666655


No 113
>PF08273 Prim_Zn_Ribbon:  Zinc-binding domain of primase-helicase;  InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry represents a zinc binding domain found in the N-terminal region of the bacteriophage T7 Gp4 and P4 alpha protein. P4 is a multifunctional protein with origin recognition, helicase and primase activities [, , ].; GO: 0003896 DNA primase activity, 0004386 helicase activity, 0008270 zinc ion binding; PDB: 1NUI_B.
Probab=22.96  E-value=26  Score=24.49  Aligned_cols=26  Identities=19%  Similarity=0.430  Sum_probs=13.4

Q ss_pred             eeccccccccCCceecC---CCChhhHHh
Q 023002          260 FACFICRKPFVDPVVTK---CKHYFCEHC  285 (289)
Q Consensus       260 ~~C~IC~~~f~dPVvT~---CGH~FC~~C  285 (289)
                      -.||+|...=+--|.+.   =||++|..|
T Consensus         4 ~pCP~CGG~DrFri~~d~~~~G~~~C~~C   32 (40)
T PF08273_consen    4 GPCPICGGKDRFRIFDDKDGRGTWICRQC   32 (40)
T ss_dssp             E--TTTT-TTTEEEETT----S-EEETTT
T ss_pred             CCCCCCcCccccccCcCcccCCCEECCCC
Confidence            35888876543333332   499999888


No 114
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=22.41  E-value=22  Score=24.97  Aligned_cols=27  Identities=26%  Similarity=0.556  Sum_probs=14.8

Q ss_pred             eccc--cccccC-----Cc--eec-CCCChhhHHhHh
Q 023002          261 ACFI--CRKPFV-----DP--VVT-KCKHYFCEHCAL  287 (289)
Q Consensus       261 ~C~I--C~~~f~-----dP--VvT-~CGH~FC~~Ci~  287 (289)
                      -||-  |...+.     +.  |.= .|||.||..|-.
T Consensus        20 ~Cp~~~C~~~~~~~~~~~~~~~~C~~C~~~fC~~C~~   56 (64)
T PF01485_consen   20 WCPNPDCEYIIEKDDGCNSPIVTCPSCGTEFCFKCGE   56 (64)
T ss_dssp             --TTSST---ECS-SSTTS--CCTTSCCSEECSSSTS
T ss_pred             CCCCCCCcccEEecCCCCCCeeECCCCCCcCccccCc
Confidence            6776  777663     12  333 499999999864


No 115
>cd04707 otoconin_90 otoconin_90: Phospholipase A2-like domains present in otoconin-90 and otoconin-95, mammal proteins that are principal matrix proteins of calcitic otoconia. Interactions involving otoconin-90 may trigger or constitute key events in otoconia formation. The PLA2-like domains in otoconins may have lost their metal-binding sites.
Probab=21.84  E-value=21  Score=30.21  Aligned_cols=20  Identities=40%  Similarity=0.963  Sum_probs=14.7

Q ss_pred             Ccccc-cccCC---------Cceeeeeecc
Q 023002          193 YKETG-YCGYG---------DSCKFMHDRG  212 (289)
Q Consensus       193 ykeTG-~CGfG---------DsCKFlHdR~  212 (289)
                      |..=| |||+|         |.|-|.||.=
T Consensus        17 Y~~YGCyCG~GG~G~PvD~~DrCC~~HD~C   46 (117)
T cd04707          17 FEDYGCYCGQEGEGLPVDELDRCCFQHRCC   46 (117)
T ss_pred             HcccCCcccCCCCCCCcccchhHHHHhHHH
Confidence            33447 99999         5788888764


No 116
>KOG3777 consensus Uncharacterized conserved protein [Function unknown]
Probab=21.80  E-value=62  Score=33.32  Aligned_cols=50  Identities=24%  Similarity=0.526  Sum_probs=32.7

Q ss_pred             cccCCCCCCCCCcCCceeee-eeeeeecCCCcCCCcccccccCCCceeeeeeccc
Q 023002          160 SSEKAGGSHGPLRASAHIRV-TARFDYQPDICKDYKETGYCGYGDSCKFMHDRGD  213 (289)
Q Consensus       160 ~~~~~~~~~GPirap~niR~-t~~~DyqPDiCKDykeTG~CGfGDsCKFlHdR~d  213 (289)
                      .+..+.|+.||--.- .||. ...|-+.++.|- |..  +|.||.-|||+|--..
T Consensus       144 pPDdplgr~GPsl~~-fL~k~p~~~aq~~q~Cp-ygk--kctyg~kck~~h~~~~  194 (443)
T KOG3777|consen  144 PPDDPLGREGPSLDN-FLSKKPLLWAQNKQPCP-YGK--KCTYGGKCKFYHPEIA  194 (443)
T ss_pred             CCCCcccccCcchhh-hhhhccchhhhcccCCC-ccc--ccCCCCceeecccccc
Confidence            345567788974432 2343 346777788784 322  8999999999996433


No 117
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=21.36  E-value=43  Score=23.98  Aligned_cols=24  Identities=29%  Similarity=0.618  Sum_probs=15.7

Q ss_pred             ceeccccccccCCcee-cCCCChhh
Q 023002          259 PFACFICRKPFVDPVV-TKCKHYFC  282 (289)
Q Consensus       259 p~~C~IC~~~f~dPVv-T~CGH~FC  282 (289)
                      .+.|||....+..||- ..|.|.-|
T Consensus         2 sL~CPls~~~i~~P~Rg~~C~H~~C   26 (50)
T PF02891_consen    2 SLRCPLSFQRIRIPVRGKNCKHLQC   26 (50)
T ss_dssp             ESB-TTTSSB-SSEEEETT--SS--
T ss_pred             eeeCCCCCCEEEeCccCCcCcccce
Confidence            4789999999999998 48999876


No 118
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=20.92  E-value=39  Score=22.70  Aligned_cols=11  Identities=27%  Similarity=0.630  Sum_probs=5.0

Q ss_pred             ceecccccccc
Q 023002          259 PFACFICRKPF  269 (289)
Q Consensus       259 p~~C~IC~~~f  269 (289)
                      .+.|+-|...|
T Consensus        25 ~vrC~~C~~~f   35 (37)
T PF13719_consen   25 KVRCPKCGHVF   35 (37)
T ss_pred             EEECCCCCcEe
Confidence            44454444443


No 119
>cd00125 PLA2c PLA2c: Phospholipase A2, a family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids (PC or phosphatidylethanolamine), usually in a metal-dependent reaction, to generate lysophospholipid (LysoPL) and a free fatty acid (FA). The resulting products are either dietary or used in synthetic pathways for leukotrienes and prostaglandins. Often, arachidonic acid is released as a free fatty acid and acts as second messenger in signaling networks. Secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis (LysoPL and FA) cannot form bilayers leading to a change in membrane conformation and ultimately to a block in 
Probab=20.52  E-value=16  Score=30.71  Aligned_cols=20  Identities=55%  Similarity=1.172  Sum_probs=13.5

Q ss_pred             CCcccc-cccCC---------Cceeeeeec
Q 023002          192 DYKETG-YCGYG---------DSCKFMHDR  211 (289)
Q Consensus       192 DykeTG-~CGfG---------DsCKFlHdR  211 (289)
                      +|..-| |||+|         |.|-|.||.
T Consensus        19 ~Y~~YGCyCG~GG~G~PvD~~DrCC~~HD~   48 (115)
T cd00125          19 DYNGYGCYCGLGGSGTPVDDTDRCCQVHDC   48 (115)
T ss_pred             HHhhcCCccCCCCCCCCcccHHHHHHHHHh
Confidence            344458 99999         466666664


No 120
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated
Probab=20.02  E-value=32  Score=32.25  Aligned_cols=26  Identities=23%  Similarity=0.623  Sum_probs=23.6

Q ss_pred             eccccccccCCceecCCCChhhHHhH
Q 023002          261 ACFICRKPFVDPVVTKCKHYFCEHCA  286 (289)
Q Consensus       261 ~C~IC~~~f~dPVvT~CGH~FC~~Ci  286 (289)
                      .|+.|......-++-..+-|||..|-
T Consensus       247 pC~~Cg~~I~~~~~~gR~t~~CP~CQ  272 (274)
T PRK01103        247 PCRRCGTPIEKIKQGGRSTFFCPRCQ  272 (274)
T ss_pred             CCCCCCCeeEEEEECCCCcEECcCCC
Confidence            59999999988888899999999994


Done!