Citrus Sinensis ID: 023024


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MAASFSSLSFFSSTIFLTSSSNKVPKPIQLAKPNSLINLPPKPLIVSSQLASPLPILSFTGEKIGETYLDLKSAAPDTARAVVHRALITDMQNKRRGTASTLTRGEVRGGGRKPYSQKKTGRARRGSNRTPLRPGGGVVFGPKPRDWSIKINKKEKRLAISTAIASAAAAENTIVVEEFDGKFERPKTKEFIEAMRRWGLDPKQKATFLVMEVSENVEKSSRNIGTLKMLTPRTLNLFDILDAETLVLTPSTVDFLNGRYGVEFEGDGDEEEEESEAREAGEESDAAE
cccccccccccHHHHHcccccccccccccccccccccccccccccccccccccEEEEcccccEEEEEEEccccccccccHHHHHHHHHHHHHHcccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEcccccccccccHHHHHHHHHHcccccccEEEEEEccccHHHHHHHccccccEEEccccccHHHHcccccEEEcHHHHHHHHHHHccccccccccHHHHHHHHHccccccccc
**********FSSTIFLTS*****************INL***PLIVSSQLASPLPILSFTGEKIGETYLDLKSAAPDTARAVVHRALITDMQNKRRGTASTL**************************RTPLRPGGGVVFGPKPRDWSIKINKKEKRLAISTAIASAAAAENTIVVEEFDGKFERPKTKEFIEAMRRWGLDPKQKATFLVMEVSENVEKSSRNIGTLKMLTPRTLNLFDILDAETLVLTPSTVDFLNGRYGV**************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAASFSSLSFFSSTIFLTSSSNKVPKPIQLAKPNSLINLPPKPLIVSSQLASPLPILSFTGEKIGETYLDLKSAAPDTARAVVHRALITDMQNKRRGTASTLTRGEVRGGGRKPYSQKKTGRARRGSNRTPLRPGGGVVFGPKPRDWSIKINKKEKRLAISTAIASAAAAENTIVVEEFDGKFERPKTKEFIEAMRRWGLDPKQKATFLVMEVSENVEKSSRNIGTLKMLTPRTLNLFDILDAETLVLTPSTVDFLNGRYGVEFEGDGDEEEEESEAREAGEESDAAE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
50S ribosomal protein L4, chloroplastic This protein binds directly and specifically to 23S rRNA (By similarity). May play a role in plastid transcriptional regulation.probableO50061
50S ribosomal protein L4, chloroplastic This protein binds directly and specifically to 23S rRNA (By similarity). May play a role in plastid transcriptional regulation.probableO80361
50S ribosomal protein L4, chloroplastic This protein (expressed without the transit peptide) is able to provoke transcription termination from the spinach chloroplast rDNA operon and the E.coli S10 operon in vitro.probableO49937

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain G
Confidence level:very confident
Coverage over the Query: 49-262
View the alignment between query and template
View the model in PyMOL