BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 023055
(288 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1GL6|A Chain A, Plasmid Coupling Protein Trwb In Complex With The Non-
Hydrolysable Gtp Analogue Gdpnp
pdb|1GL6|B Chain B, Plasmid Coupling Protein Trwb In Complex With The Non-
Hydrolysable Gtp Analogue Gdpnp
pdb|1GL6|D Chain D, Plasmid Coupling Protein Trwb In Complex With The Non-
Hydrolysable Gtp Analogue Gdpnp
pdb|1GL6|E Chain E, Plasmid Coupling Protein Trwb In Complex With The Non-
Hydrolysable Gtp Analogue Gdpnp
pdb|1GL6|F Chain F, Plasmid Coupling Protein Trwb In Complex With The Non-
Hydrolysable Gtp Analogue Gdpnp
pdb|1GL6|G Chain G, Plasmid Coupling Protein Trwb In Complex With The Non-
Hydrolysable Gtp Analogue Gdpnp
Length = 436
Score = 29.3 bits (64), Expect = 2.6, Method: Compositional matrix adjust.
Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 7/48 (14%)
Query: 139 MVKKFSEDFQIMLFHYDGQTSQW-------DEFEWSKSAIHVSIRRQT 179
M+ KF D I+L YD +T W ++++W + A+ V R +T
Sbjct: 92 MLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKT 139
>pdb|1E9R|A Chain A, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Trigonal Form In Complex With Sulphate.
pdb|1E9R|B Chain B, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Trigonal Form In Complex With Sulphate.
pdb|1E9R|D Chain D, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Trigonal Form In Complex With Sulphate.
pdb|1E9R|E Chain E, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Trigonal Form In Complex With Sulphate.
pdb|1E9R|F Chain F, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Trigonal Form In Complex With Sulphate.
pdb|1E9R|G Chain G, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Trigonal Form In Complex With Sulphate.
pdb|1E9S|A Chain A, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9S|B Chain B, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9S|D Chain D, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9S|E Chain E, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9S|F Chain F, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9S|G Chain G, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9S|H Chain H, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9S|I Chain I, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9S|J Chain J, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9S|K Chain K, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9S|L Chain L, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1E9S|M Chain M, Bacterial Conjugative Coupling Protein Trwbdeltan70.
Unbound Monoclinic Form.
pdb|1GKI|A Chain A, Plasmid Coupling Protein Trwb In Complex With Adp And
Mg2+.
pdb|1GKI|B Chain B, Plasmid Coupling Protein Trwb In Complex With Adp And
Mg2+.
pdb|1GKI|D Chain D, Plasmid Coupling Protein Trwb In Complex With Adp And
Mg2+.
pdb|1GKI|E Chain E, Plasmid Coupling Protein Trwb In Complex With Adp And
Mg2+.
pdb|1GKI|F Chain F, Plasmid Coupling Protein Trwb In Complex With Adp And
Mg2+.
pdb|1GKI|G Chain G, Plasmid Coupling Protein Trwb In Complex With Adp And
Mg2+.
pdb|1GL7|A Chain A, Plasmid Coupling Protein Trwb In Complex With The Non-
Hydrolisable Atp-Analogue Adpnp.
pdb|1GL7|B Chain B, Plasmid Coupling Protein Trwb In Complex With The Non-
Hydrolisable Atp-Analogue Adpnp.
pdb|1GL7|D Chain D, Plasmid Coupling Protein Trwb In Complex With The Non-
Hydrolisable Atp-Analogue Adpnp.
pdb|1GL7|E Chain E, Plasmid Coupling Protein Trwb In Complex With The Non-
Hydrolisable Atp-Analogue Adpnp.
pdb|1GL7|F Chain F, Plasmid Coupling Protein Trwb In Complex With The Non-
Hydrolisable Atp-Analogue Adpnp.
pdb|1GL7|G Chain G, Plasmid Coupling Protein Trwb In Complex With The Non-
Hydrolisable Atp-Analogue Adpnp
Length = 437
Score = 29.3 bits (64), Expect = 2.6, Method: Compositional matrix adjust.
Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 7/48 (14%)
Query: 139 MVKKFSEDFQIMLFHYDGQTSQW-------DEFEWSKSAIHVSIRRQT 179
M+ KF D I+L YD +T W ++++W + A+ V R +T
Sbjct: 93 MLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKT 140
>pdb|3SV0|A Chain A, Crystal Structure Of Casein Kinase-1 Like Protein In
Plant
Length = 483
Score = 28.5 bits (62), Expect = 4.3, Method: Compositional matrix adjust.
Identities = 14/34 (41%), Positives = 23/34 (67%)
Query: 31 YFVGRSFQSVSFSKIHLPTSISTSFDIAGKEENI 64
+ +GR S SF +I+L T+I T+ ++A K EN+
Sbjct: 9 FRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENV 42
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.137 0.428
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,148,271
Number of Sequences: 62578
Number of extensions: 394884
Number of successful extensions: 840
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 839
Number of HSP's gapped (non-prelim): 4
length of query: 288
length of database: 14,973,337
effective HSP length: 98
effective length of query: 190
effective length of database: 8,840,693
effective search space: 1679731670
effective search space used: 1679731670
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)