Citrus Sinensis ID: 023089

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------
MACSLKCGISVSVSVMNETFPSSKDKSIVGFCSSRAPPSQVRVLTSKSISKILPAFSIHFKGQSLAVSDHKSLTLWHVKAPNKFSINAQASICVSRAMRWWEKTLKPNMIEIQSAQELVDALRNGGDRLVILDFYSPGCGGCKSLHPKICQLAELNPNAIFLKVNYEELKTMCHSLHIHVLPFFKFYRGSEGHLCSFSCTNATIKKFKDALAKHGTDRCSLGPAKGLDESELLKLASINELSINLPLPSAVGEEVEDLVMQSSIDLSGILSKAGENKTALQGEGVLL
cccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHcccccccEEEEEEcccccEEEEEECcccHHHHHHHHHHHccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccCECcccccc
******CGISVSVS*************IV*******************ISKILPAFSIHFKGQSLAVSDHK**********NKFSINAQASICVSRAMRWWEKTLKPNMIEIQSAQELVDALRNGGDRLVILDFYSPGCGGCKSLHPKICQLAELNPNAIFLKVNYEELKTMCHSLHIHVLPFFKFYRGSEGHLCSFSCTNATIKKFKDALAKHGTDRCSLGPA*GL**SELLKLASINELSINLPLPSAVG******V****I****************QGEGVLL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MACSLKCGISVSVSVMNETFPSSKDKSIVGFCSSRAPPSQVRVLTSKSISKILPAFSIHFKGQSLAVSDHKSLTLWHVKAPNKFSINAQASICVSRAMRWWEKTLKPNMIEIQSAQELVDALRNGGDRLVILDFYSPGCGGCKSLHPKICQLAELNPNAIFLKVNYEELKTMCHSLHIHVLPFFKFYRGSEGHLCSFSCTNATIKKFKDALAKHGTDRCSLGPAKGLDESELLKLASINELSINLPLPSAVGEEVEDLVMQSSIDLSGILSKAGENKTALQGEGVLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thioredoxin-like 1-2, chloroplastic Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.probableQ9XFI1
Thioredoxin-like 1-1, chloroplastic Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.probableQ6Z4N3
Thioredoxin-like 1-2, chloroplastic Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.probableQ10M18

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3APO, chain A
Confidence level:very confident
Coverage over the Query: 20-85,102-217
View the alignment between query and template
View the model in PyMOL