Citrus Sinensis ID: 023099

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------

MPVYVDREAPKLWRKICSETTIEISLLAENWKIILGGIIFQYIHGLAAHAVHYLHQPGPLLQDSGYALIPELGEDKAYISETLFSFLFFSFVLWTFHPFVFQSKSFHTVLLWCRVLACLVVCQMLRIVTFYSTQLPGPNYHCREGSKLARLPRPESVVEVLLINFPRGMIYGCGDLIFSSHMIFTLLFVLTYHKYGTIRFIKQSAWLLAIIESLLIIASRKHYTVDVVVAWYTVNLVVFFINKKLPELPDRSNASASLQFLPVSSRDKDGRNKDELHRSNNGTSGHI

ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHEEEEEcccccccccccccccccccccHHHHHHHEEEccccccccccccEEcHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHcccccccccc

**VY*DREAPKLWRKICSETTIEISLLAENWKIILGGIIFQYIHGLAAHAVHYLHQPGPLLQDSGYALIPELGEDKAYISETLFSFLFFSFVLWTFHPFVFQSKSFHTVLLWCRVLACLVVCQMLRIVTFYSTQLPGPNYHCREGSKLARLPRPESVVEVLLINFPRGMIYGCGDLIFSSHMIFTLLFVLTYHKYGTIRFIKQSAWLLAIIESLLIIASRKHYTVDVVVAWYTVNLVVFFINKKLPELPDRSNASASLQFLPVSSR*********************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Phosphatidylinositol:ceramide inositolphosphotransferase	Catalyzes the transfer of the phosphorylinositol group from phosphatidylinositol (PI) to phytoceramide, an essential step in sphingolipid biosynthesis. May play an important role in modulating plant programmed cell death (PCD) associated with defense by promoting sphingolipid metabolism and regulating ceramide accumulation.	confident	Q5N7A7
Phosphatidylinositol:ceramide inositolphosphotransferase	Catalyzes the transfer of the phosphorylinositol group from phosphatidylinositol (PI) to phytoceramide, an essential step in sphingolipid biosynthesis. May play an important role in modulating plant programmed cell death (PCD) associated with defense (e.g. toward Golovinomyces cichoracearum) by promoting sphingolipid metabolism and regulating ceramide accumulation.	probable	B8ACH9
Phosphatidylinositol:ceramide inositolphosphotransferase 1	Catalyzes the transfer of the phosphorylinositol group from phosphatidylinositol (PI) to phytoceramide, an essential step in sphingolipid biosynthesis.	probable	Q9M325

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1D2T, chain A
Confidence level:probable
Coverage over the Query: 176-241
View the alignment between query and template
View the model in PyMOL