BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 023104
(287 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2P1N|C Chain C, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase
pdb|2P1N|F Chain F, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase
pdb|2P1O|C Chain C, Mechanism Of Auxin Perception By The Tir1 Ubiquitin Ligase
pdb|2P1Q|C Chain C, Mechanism Of Auxin Perception By The Tir1 Ubiquitin Ligase
Length = 13
Score = 28.9 bits (63), Expect = 3.1, Method: Composition-based stats.
Identities = 10/12 (83%), Positives = 11/12 (91%)
Query: 112 QVVGWPPIRAYR 123
QVVGWPP+R YR
Sbjct: 1 QVVGWPPVRNYR 12
>pdb|3C7A|A Chain A, A Structural Basis For Substrate And Stereo Selectivity In
Octopine Dehydrogenase (Odh-Nadh)
pdb|3C7D|B Chain B, A Structural Basis For Substrate And Stereo Selectivity In
Octopine Dehydrogenase (Odh-Nadh-Pyruvate)
pdb|3C7C|B Chain B, A Structural Basis For Substrate And Stereo Selectivity In
Octopine Dehydrogenase (Odh-Nadh-L-Arginine)
Length = 404
Score = 28.1 bits (61), Expect = 5.5, Method: Compositional matrix adjust.
Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 10/62 (16%)
Query: 195 YESLVQTLEDMFHQPTTRSSVQEPTRPSKLLDG--TSDYVLTYEDKEGDWMLVGDVPWGM 252
Y +Q D++H TT S + P K +DG D+ G+ L D+P GM
Sbjct: 283 YHEDIQDDHDLYHAITTNKSYKGLVHPVKAVDGGVAPDF--------GNRYLTEDIPMGM 334
Query: 253 FL 254
+
Sbjct: 335 IV 336
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.313 0.126 0.359
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,001,891
Number of Sequences: 62578
Number of extensions: 204969
Number of successful extensions: 366
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 363
Number of HSP's gapped (non-prelim): 6
length of query: 287
length of database: 14,973,337
effective HSP length: 98
effective length of query: 189
effective length of database: 8,840,693
effective search space: 1670890977
effective search space used: 1670890977
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 51 (24.3 bits)