BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 023104
         (287 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2P1N|C Chain C, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase
 pdb|2P1N|F Chain F, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase
 pdb|2P1O|C Chain C, Mechanism Of Auxin Perception By The Tir1 Ubiquitin Ligase
 pdb|2P1Q|C Chain C, Mechanism Of Auxin Perception By The Tir1 Ubiquitin Ligase
          Length = 13

 Score = 28.9 bits (63), Expect = 3.1,   Method: Composition-based stats.
 Identities = 10/12 (83%), Positives = 11/12 (91%)

Query: 112 QVVGWPPIRAYR 123
           QVVGWPP+R YR
Sbjct: 1   QVVGWPPVRNYR 12


>pdb|3C7A|A Chain A, A Structural Basis For Substrate And Stereo Selectivity In
           Octopine Dehydrogenase (Odh-Nadh)
 pdb|3C7D|B Chain B, A Structural Basis For Substrate And Stereo Selectivity In
           Octopine Dehydrogenase (Odh-Nadh-Pyruvate)
 pdb|3C7C|B Chain B, A Structural Basis For Substrate And Stereo Selectivity In
           Octopine Dehydrogenase (Odh-Nadh-L-Arginine)
          Length = 404

 Score = 28.1 bits (61), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 10/62 (16%)

Query: 195 YESLVQTLEDMFHQPTTRSSVQEPTRPSKLLDG--TSDYVLTYEDKEGDWMLVGDVPWGM 252
           Y   +Q   D++H  TT  S +    P K +DG    D+        G+  L  D+P GM
Sbjct: 283 YHEDIQDDHDLYHAITTNKSYKGLVHPVKAVDGGVAPDF--------GNRYLTEDIPMGM 334

Query: 253 FL 254
            +
Sbjct: 335 IV 336


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.313    0.126    0.359 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,001,891
Number of Sequences: 62578
Number of extensions: 204969
Number of successful extensions: 366
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 363
Number of HSP's gapped (non-prelim): 6
length of query: 287
length of database: 14,973,337
effective HSP length: 98
effective length of query: 189
effective length of database: 8,840,693
effective search space: 1670890977
effective search space used: 1670890977
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 51 (24.3 bits)