Query         023124
Match_columns 287
No_of_seqs    100 out of 126
Neff          3.5 
Searched_HMMs 46136
Date          Fri Mar 29 08:36:43 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/023124.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/023124hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF11891 DUF3411:  Domain of un 100.0   2E-39 4.4E-44  285.3   6.3  102  180-283     1-103 (180)
  2 PLN03138 Protein TOC75; Provis  93.8    0.16 3.4E-06   54.6   7.0   21    2-22      5-25  (796)
  3 COG4907 Predicted membrane pro  91.5    0.15 3.1E-06   52.4   2.9    6   32-37    548-553 (595)
  4 TIGR02877 spore_yhbH sporulati  86.6     2.5 5.5E-05   42.1   7.5   15  119-133   112-126 (371)
  5 PRK05325 hypothetical protein;  86.1     2.4 5.2E-05   42.5   7.1   14  120-133   101-114 (401)
  6 PF04285 DUF444:  Protein of un  84.7     2.9 6.2E-05   42.2   6.9   13  119-131   116-128 (421)
  7 COG1512 Beta-propeller domains  83.3     1.2 2.6E-05   42.4   3.5   14   81-94    238-251 (271)
  8 PHA00370 III attachment protei  79.1     4.7  0.0001   38.9   5.8   16  201-216   244-259 (297)
  9 PF02084 Bindin:  Bindin;  Inte  77.0     6.4 0.00014   37.3   5.9   25  124-148   107-131 (238)
 10 KOG3915 Transcription regulato  75.8     2.3 4.9E-05   44.1   2.9    9  219-227   204-212 (641)
 11 PTZ00146 fibrillarin; Provisio  72.3     4.4 9.5E-05   39.0   3.8   10  218-227   202-211 (293)
 12 PHA00370 III attachment protei  70.9     6.2 0.00013   38.2   4.4   14  153-166   213-226 (297)
 13 TIGR01659 sex-lethal sex-letha  69.4     6.2 0.00013   38.3   4.1   36   28-63    237-272 (346)
 14 PTZ00146 fibrillarin; Provisio  68.3     5.7 0.00012   38.2   3.6    8  158-165   136-143 (293)
 15 KOG0921 Dosage compensation co  68.1     5.1 0.00011   44.7   3.6   21   64-84   1206-1226(1282)
 16 PF02979 NHase_alpha:  Nitrile   65.3     8.1 0.00018   35.5   3.8   43  145-187    17-65  (188)
 17 PF04285 DUF444:  Protein of un  57.1      11 0.00025   38.0   3.6   10   59-68     51-60  (421)
 18 PRK05325 hypothetical protein;  56.8      12 0.00026   37.7   3.7   13   58-70     37-49  (401)
 19 PF08671 SinI:  Anti-repressor   53.3      10 0.00023   25.3   1.8   21  141-162     9-29  (30)
 20 PRK05255 hypothetical protein;  45.4 1.4E+02  0.0031   26.8   8.2   17  173-189   107-124 (171)
 21 PRK07772 single-stranded DNA-b  45.1      39 0.00085   30.6   4.7    6    7-12     30-35  (186)
 22 PLN03134 glycine-rich RNA-bind  44.0      31 0.00067   29.3   3.7    8   29-36     79-86  (144)
 23 KOG3074 Transcriptional regula  42.9      15 0.00034   35.1   1.8   15  116-130    45-59  (263)
 24 PF07631 PSD4:  Protein of unkn  42.5      96  0.0021   26.3   6.4   42  127-188     8-51  (128)
 25 COG3028 Uncharacterized protei  41.4      77  0.0017   29.2   5.9   15  171-185   115-129 (187)
 26 COG2718 Uncharacterized conser  38.8      50  0.0011   33.8   4.7   17  117-133   114-130 (423)
 27 KOG0105 Alternative splicing f  37.5      28  0.0006   32.8   2.6   18   26-43     45-62  (241)
 28 PRK07772 single-stranded DNA-b  36.3      47   0.001   30.1   3.8   11   57-67     74-84  (186)
 29 TIGR02877 spore_yhbH sporulati  35.4      37  0.0008   34.1   3.2   14   57-70     48-61  (371)
 30 COG2718 Uncharacterized conser  35.3      29 0.00062   35.4   2.5   11  102-112   103-113 (423)
 31 PRK12799 motB flagellar motor   34.7      31 0.00066   35.1   2.6   26  218-243    26-51  (421)
 32 KOG1456 Heterogeneous nuclear   34.5      31 0.00067   35.3   2.6   56  138-193    45-123 (494)
 33 PF13677 MotB_plug:  Membrane M  33.3      52  0.0011   24.3   3.0   27  217-243    15-41  (58)
 34 TIGR03795 chp_BMA0021 conserve  31.8      31 0.00067   29.4   1.8   28  158-187    10-39  (114)
 35 TIGR01323 nitrile_alph nitrile  29.9      52  0.0011   30.3   3.0   43  145-187    11-59  (185)
 36 PF00813 FliP:  FliP family;  I  28.9 2.9E+02  0.0063   25.6   7.6   28  219-246   145-172 (194)
 37 PF10415 FumaraseC_C:  Fumarase  28.6      75  0.0016   23.4   3.1   37  123-162    14-50  (55)
 38 PF06524 NOA36:  NOA36 protein;  27.5      77  0.0017   31.1   3.8    7   59-65    224-230 (314)
 39 PF02422 Keratin:  Keratin;  In  24.4 1.4E+02  0.0031   25.0   4.4   31   44-74     24-56  (98)
 40 KOG3074 Transcriptional regula  24.4      47   0.001   31.9   1.8   10  225-234   159-168 (263)
 41 TIGR00625 tfb2 Transcription f  24.0      79  0.0017   32.5   3.4   67  125-192   313-399 (448)
 42 PF15207 TMEM240:  TMEM240 fami  23.9      88  0.0019   28.3   3.3   26  214-240    83-108 (180)
 43 PRK06925 flagellar motor prote  23.5      72  0.0016   29.0   2.8   26  217-242    13-38  (230)
 44 TIGR03793 TOMM_pelo TOMM prope  23.2      50  0.0011   26.0   1.5   17  171-187    10-28  (77)
 45 PRK09038 flagellar motor prote  22.9      75  0.0016   30.0   2.8   26  217-242    15-40  (281)
 46 KOG0105 Alternative splicing f  22.8 1.9E+02  0.0041   27.4   5.3   12   72-83     74-85  (241)
 47 PRK07734 motB flagellar motor   22.0      72  0.0016   29.5   2.5   26  217-242    17-42  (259)
 48 KOG3570 MAPK-activating protei  21.6 1.7E+02  0.0036   33.6   5.3   71   18-94     40-122 (1588)
 49 TIGR01659 sex-lethal sex-letha  20.9   1E+02  0.0022   30.0   3.4    6   27-32    194-199 (346)
 50 PF05084 GRA6:  Granule antigen  20.4 1.4E+02  0.0029   27.7   3.8   20   24-43    100-119 (215)
 51 PF12244 DUF3606:  Protein of u  20.2 1.9E+02   0.004   21.4   3.9   34  127-160    23-56  (57)
 52 PRK06958 single-stranded DNA-b  20.1 1.1E+02  0.0023   27.9   3.1   11   57-67     73-83  (182)

No 1  
>PF11891 DUF3411:  Domain of unknown function (DUF3411);  InterPro: IPR021825  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 168 to 186 amino acids in length. This domain has a conserved RYQ sequence motif. 
Probab=100.00  E-value=2e-39  Score=285.29  Aligned_cols=102  Identities=45%  Similarity=0.742  Sum_probs=96.9

Q ss_pred             hhhhcCcchhHHHhHHhhhhhhhhhhhhhhhccccchhhHHHHHHHHHHHHHHHHHhHhhcccccccCCCCcc-Ccchhh
Q 023124          180 DRMLADPSFLFKVGTEIVIDSCCATLAEFQKRGKDFWSEFELYLADLLVGLVVDIALVGMLAPYARIGQPSAS-SGLFGR  258 (287)
Q Consensus       180 ~RlLADP~FlfKl~~E~~i~i~~~~~~E~~~Rge~f~~ElDfV~adlv~~~i~nfaLV~lLAPt~s~g~~~~s-~g~~~~  258 (287)
                      +||||||+|||||++||+||++|+++|||++|||+||+|||||++|+|+++|+||+||||||||+++++++++ .+  +.
T Consensus         1 ~RllADP~Fl~Kl~~E~~i~i~~~~~~e~~~R~e~f~~E~d~v~~d~v~~~i~n~~lv~llAPt~s~~~~~~~~~~--~~   78 (180)
T PF11891_consen    1 ERLLADPSFLFKLAIEEVIGIGCATAAEYAKRGERFWNELDFVFSDVVVGSIVNFALVWLLAPTRSFGSPAASSPG--GG   78 (180)
T ss_pred             CcccccchHHHHHHHHHHHHHHHHHHHHHHHcccchHHHHHHHHHHHHHHHHHHHHHHHhccchHhhCcccccccc--hH
Confidence            6999999999999999999999999999999999999999999999999999999999999999999998863 33  79


Q ss_pred             HHhhhcCCCchhHHhhhhhhhhhhh
Q 023124          259 IQNACGSLPSSYMLLLLVIDRFHNE  283 (287)
Q Consensus       259 l~~~~~~LP~n~Fe~~~p~rrf~~~  283 (287)
                      ||+.+++||+|+||+.+|+|+|+..
T Consensus        79 ~~~~~~~~P~n~Fq~~~~g~~fsl~  103 (180)
T PF11891_consen   79 LQKFLGSLPNNAFQKGYPGRSFSLA  103 (180)
T ss_pred             HHHHHHhChHHHhccCCCCCcccHH
Confidence            9999999999999999999999754


No 2  
>PLN03138 Protein TOC75; Provisional
Probab=93.77  E-value=0.16  Score=54.60  Aligned_cols=21  Identities=24%  Similarity=0.176  Sum_probs=16.0

Q ss_pred             CcccccccCCCCCCCCCCCCc
Q 023124            2 SACSSTFRLPNLPNISPQNHN   22 (287)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~   22 (287)
                      ++|.+.++-++++.-.||+..
T Consensus         5 ~~~~~~~~~~~~~~~~~~~~~   25 (796)
T PLN03138          5 STMVSAAASTSLSSSRPQLSS   25 (796)
T ss_pred             cccceeccCCCccCCCccccc
Confidence            578888888888887777654


No 3  
>COG4907 Predicted membrane protein [Function unknown]
Probab=91.49  E-value=0.15  Score=52.45  Aligned_cols=6  Identities=0%  Similarity=0.058  Sum_probs=2.5

Q ss_pred             eecccC
Q 023124           32 SLRHST   37 (287)
Q Consensus        32 ~~~~s~   37 (287)
                      -+||+-
T Consensus       548 i~h~ny  553 (595)
T COG4907         548 IFHNNY  553 (595)
T ss_pred             EEecch
Confidence            344443


No 4  
>TIGR02877 spore_yhbH sporulation protein YhbH. This protein family, typified by YhbH in Bacillus subtilis, is found in nearly every endospore-forming bacterium and in no other genome (but note that the trusted cutoff score is set high to exclude a single high-scoring sequence from Nitrosococcus oceani ATCC 19707, which is classified in the Gammaproteobacteria). The gene in Bacillus subtilis was shown to be in the regulon of the sporulation sigma factor, sigma-E, and its mutation was shown to create a sporulation defect.
Probab=86.58  E-value=2.5  Score=42.09  Aligned_cols=15  Identities=13%  Similarity=0.155  Sum_probs=10.4

Q ss_pred             ccccHHHHHHHHHhc
Q 023124          119 PILKFEEVMKEIELK  133 (287)
Q Consensus       119 ~ll~~~~Vl~ea~r~  133 (287)
                      -=++.+|+++....-
T Consensus       112 ~e~s~eE~~~~lfEd  126 (371)
T TIGR02877       112 TEVTLEELFELLFED  126 (371)
T ss_pred             EEecHHHHHHHHHhh
Confidence            347788888887543


No 5  
>PRK05325 hypothetical protein; Provisional
Probab=86.14  E-value=2.4  Score=42.55  Aligned_cols=14  Identities=14%  Similarity=0.199  Sum_probs=10.0

Q ss_pred             cccHHHHHHHHHhc
Q 023124          120 ILKFEEVMKEIELK  133 (287)
Q Consensus       120 ll~~~~Vl~ea~r~  133 (287)
                      =++.+|++......
T Consensus       101 els~eE~~~~lfEd  114 (401)
T PRK05325        101 EISLEELLDLLFED  114 (401)
T ss_pred             EecHHHHHHHHHhh
Confidence            47788888877544


No 6  
>PF04285 DUF444:  Protein of unknown function (DUF444);  InterPro: IPR006698 This entry is represented by Thermus phage phiYS40, Orf56. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches [].
Probab=84.69  E-value=2.9  Score=42.22  Aligned_cols=13  Identities=23%  Similarity=0.031  Sum_probs=9.0

Q ss_pred             ccccHHHHHHHHH
Q 023124          119 PILKFEEVMKEIE  131 (287)
Q Consensus       119 ~ll~~~~Vl~ea~  131 (287)
                      --++.++++....
T Consensus       116 ~els~eE~~~llf  128 (421)
T PF04285_consen  116 FELSREEFLDLLF  128 (421)
T ss_pred             EEEEHHHHHHHhH
Confidence            4577788777763


No 7  
>COG1512 Beta-propeller domains of methanol dehydrogenase type [General function prediction only]
Probab=83.27  E-value=1.2  Score=42.37  Aligned_cols=14  Identities=50%  Similarity=1.025  Sum_probs=5.5

Q ss_pred             CCCCCCCCCCCCCC
Q 023124           81 GGDGGAGDSPGGGG   94 (287)
Q Consensus        81 ~G~Gg~g~~~~~gg   94 (287)
                      +|.|++|+.+|+++
T Consensus       238 ~g~g~~g~~gg~~~  251 (271)
T COG1512         238 SGSGGSGGSGGGSS  251 (271)
T ss_pred             CCCCCCCCCCCCCC
Confidence            34444433433333


No 8  
>PHA00370 III attachment protein
Probab=79.14  E-value=4.7  Score=38.94  Aligned_cols=16  Identities=19%  Similarity=0.270  Sum_probs=6.6

Q ss_pred             hhhhhhhhhhccccch
Q 023124          201 CCATLAEFQKRGKDFW  216 (287)
Q Consensus       201 ~~~~~~E~~~Rge~f~  216 (287)
                      .|.-+.+++---.+|.
T Consensus       244 ~C~~FV~~~geVYe~~  259 (297)
T PHA00370        244 GCTPFVFAQGKVYEFI  259 (297)
T ss_pred             CCCcceeeccchhhhh
Confidence            3444444444333333


No 9  
>PF02084 Bindin:  Bindin;  InterPro: IPR000775 Bindin, the major protein component of the acrosome granule of sea urchin sperm, mediates species-specific adhesion of sperm to the egg surface during fertilisation [, ]. The protein coats the acrosomal process after externalisation by the acrosome reaction; it binds to sulphated, fucose-containing polysaccharides on the vitelline-layer receptor proteoglycans that cover the egg plasma membrane. Bindins from different genera show high levels of sequence similarity in both the mature bindin domain and in the probindin precursor region. The most highly conserved region is a 42-residue segment in the central portion of the mature bindin protein. This domain may be responsible for conserved functions of bindin, while the more highly divergent flanking regions may be responsible for its species-specific properties [].; GO: 0007342 fusion of sperm to egg plasma membrane
Probab=76.97  E-value=6.4  Score=37.25  Aligned_cols=25  Identities=16%  Similarity=0.256  Sum_probs=16.5

Q ss_pred             HHHHHHHHhcCCCchHHHHHHHHHc
Q 023124          124 EEVMKEIELKGVGLPDDMMEAAKTV  148 (287)
Q Consensus       124 ~~Vl~ea~r~~~sLPaDl~~Aa~~g  148 (287)
                      +.+.+-+.+|..+||-|+-+-++.|
T Consensus       107 ~~ikavLgaTKiDLPVDINDPYDlG  131 (238)
T PF02084_consen  107 EDIKAVLGATKIDLPVDINDPYDLG  131 (238)
T ss_pred             HHHHHHhcccccccccccCChhhHH
Confidence            3344445788999998886655444


No 10 
>KOG3915 consensus Transcription regulator dachshund, contains SKI/SNO domain [Transcription]
Probab=75.75  E-value=2.3  Score=44.12  Aligned_cols=9  Identities=44%  Similarity=1.058  Sum_probs=4.1

Q ss_pred             HHHHHHHHH
Q 023124          219 FELYLADLL  227 (287)
Q Consensus       219 lDfV~adlv  227 (287)
                      ||+++-++|
T Consensus       204 fdlFLKhlV  212 (641)
T KOG3915|consen  204 FDLFLKHLV  212 (641)
T ss_pred             HHHHHHHHh
Confidence            444444444


No 11 
>PTZ00146 fibrillarin; Provisional
Probab=72.33  E-value=4.4  Score=39.01  Aligned_cols=10  Identities=20%  Similarity=0.388  Sum_probs=6.8

Q ss_pred             hHHHHHHHHH
Q 023124          218 EFELYLADLL  227 (287)
Q Consensus       218 ElDfV~adlv  227 (287)
                      .+|+||+|+.
T Consensus       202 ~vDvV~~Dva  211 (293)
T PTZ00146        202 MVDVIFADVA  211 (293)
T ss_pred             CCCEEEEeCC
Confidence            3677777764


No 12 
>PHA00370 III attachment protein
Probab=70.87  E-value=6.2  Score=38.15  Aligned_cols=14  Identities=14%  Similarity=-0.090  Sum_probs=5.5

Q ss_pred             HHHHHHHhhcCCcc
Q 023124          153 MFLLRYLDLQGSVW  166 (287)
Q Consensus       153 a~L~Rfl~L~~sp~  166 (287)
                      ++|...=+=+.+||
T Consensus       213 s~md~lg~g~gS~~  226 (297)
T PHA00370        213 SEMDQLGEGDGSPL  226 (297)
T ss_pred             hhhhhhcccCCcHH
Confidence            34443333344443


No 13 
>TIGR01659 sex-lethal sex-lethal family splicing factor. This model describes the sex-lethal family of splicing factors found in Dipteran insects. The sex-lethal phenotype, however, may be limited to the Melanogasters and closely related species. In Drosophila the protein acts as an inhibitor of splicing. This subfamily is most closely related to the ELAV/HUD subfamily of splicing factors (TIGR01661).
Probab=69.37  E-value=6.2  Score=38.30  Aligned_cols=36  Identities=19%  Similarity=0.284  Sum_probs=17.5

Q ss_pred             eeeEeecccCCCCcccccccccCCCCCCCCceeeec
Q 023124           28 TVFLSLRHSTATNPALCKLQCVGNNFDSTPKTIEIP   63 (287)
Q Consensus        28 ~~~~~~~~s~~~~~~~~~~~c~~~~~~~~p~~iei~   63 (287)
                      ..|++|.+-.--..|+..+...--+....+++|.+.
T Consensus       237 ~aFV~F~~~e~A~~Ai~~lng~~~~g~~~~l~V~~a  272 (346)
T TIGR01659       237 VAFVRFNKREEAQEAISALNNVIPEGGSQPLTVRLA  272 (346)
T ss_pred             EEEEEECCHHHHHHHHHHhCCCccCCCceeEEEEEC
Confidence            457777665555555533332211223346665543


No 14 
>PTZ00146 fibrillarin; Provisional
Probab=68.26  E-value=5.7  Score=38.24  Aligned_cols=8  Identities=25%  Similarity=0.156  Sum_probs=3.5

Q ss_pred             HHhhcCCc
Q 023124          158 YLDLQGSV  165 (287)
Q Consensus       158 fl~L~~sp  165 (287)
                      .|||=+.+
T Consensus       136 VLDLGaG~  143 (293)
T PTZ00146        136 VLYLGAAS  143 (293)
T ss_pred             EEEeCCcC
Confidence            34444443


No 15 
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]
Probab=68.09  E-value=5.1  Score=44.70  Aligned_cols=21  Identities=14%  Similarity=0.287  Sum_probs=10.1

Q ss_pred             CCcccccCCCCcccccCCCCC
Q 023124           64 GKITEESADCEPRIHSSGGDG   84 (287)
Q Consensus        64 g~it~ts~~~~~~~~~~~G~G   84 (287)
                      |+-....+..++....+.|+|
T Consensus      1206 GGYGgsa~~~~~~~Gagvg~G 1226 (1282)
T KOG0921|consen 1206 GGYGGSAPSARANYGAGVGNG 1226 (1282)
T ss_pred             CCCCCCCCCCCCCccccccCC
Confidence            334444555555555444433


No 16 
>PF02979 NHase_alpha:  Nitrile hydratase, alpha chain;  InterPro: IPR004232 Nitrile hydratases (4.2.1.84 from EC) are bacterial enzymes that catalyse the hydration of nitrile compounds to the corresponding amides. They are used as biocatalysts in acrylamide production, one of the few commercial scale bioprocesses, as well as in environmental remediation for the removal of nitriles from waste streams. Nitrile hydratases are composed of two subunits, alpha and beta, and are normally active as a tetramer, alpha(2)beta(2). Nitrile hydratases contain either a non-haem iron or a non-corrinoid cobalt centre, both types sharing a highly conserved peptide sequence in the alpha subunit (CXLCSC) that provides all the residues involved in coordinating the metal ion. Each type of nitrile hydratase specifically incorporated its metal with the help of activator proteins encoded by flanking regions of the nitrile hydratase genes that are necessary for metal insertion. The Fe-containing enzyme is photo-regulated: in the dark the enzyme is inactivated due to the association of nitric oxide (NO) to the iron, while in the light the enzyme is active by photo-dissociation of NO. The NO is held in place by a claw setting formed through specific oxygen atoms in two modified cysteines and a serine residue in the active site [, ]. The cobalt-containing enzyme is unaffected by NO, but was shown to undergo a similar effect with carbon monoxide [, ]. Fe- and cobalt-containing enzymes also display different inhibition patterns with nitrophenols. Thiocyanate hydrolase (SCNase) is a cobalt-containing metalloenzyme with a cysteine-sulphinic acid ligand that hydrolyses thiocyanate to carbonyl sulphide and ammonia []. The two enzymes, nitrile hydratase and SCNase, are homologous over regions corresponding to almost the entire coding regions of the genes: the beta and alpha subunits of thiocyanate hydrolase were homologous to the amino- and carboxyl-terminal halves of the beta subunit of nitrile hydratase, and the gamma subunit of thiocyanate hydrolase was homologous to the alpha subunit of nitrile hydratase [].  This entry represents the structural domain of the alpha subunit of both iron- and cobalt-containing nitrile hydratases; the alpha subunit is a duplication of two structural repeats, each consisting of 4 layers, alpha/beta/beta/alpha []. This structure is also found in the related protein, the gamma subunit of thiocyanate hydrolase (SCNase).; GO: 0003824 catalytic activity, 0046914 transition metal ion binding, 0006807 nitrogen compound metabolic process; PDB: 2DPP_A 3HHT_A 1V29_A 2ZZD_I 2DXC_F 2DXB_F 2DD5_C 2DD4_C 2ZPH_A 2CYZ_A ....
Probab=65.29  E-value=8.1  Score=35.48  Aligned_cols=43  Identities=21%  Similarity=0.164  Sum_probs=30.7

Q ss_pred             HHHcCCCHHHHHHHHhhcCC---cch-hHHHHHHh--hhhhhhhhcCcc
Q 023124          145 AKTVGIRKMFLLRYLDLQGS---VWP-LGFLMRYC--FMLRDRMLADPS  187 (287)
Q Consensus       145 a~~g~is~a~L~Rfl~L~~s---p~~-l~~L~r~~--~g~r~RlLADP~  187 (287)
                      ++.|.|+++.+.++++...+   |-. .+-+.|++  +.||.|||+||.
T Consensus        17 ~ekg~~~~~~~~~~~~~~~~~~~P~~GarvVArAW~Dp~FK~rLLaD~~   65 (188)
T PF02979_consen   17 IEKGLITPAEVDRIIETYESRVGPRNGARVVARAWTDPAFKARLLADPT   65 (188)
T ss_dssp             HHTTSS-HHHHHHHHHHHHHTSSHHHHHHHHHHHHH-HHHHHHHHHSHH
T ss_pred             HHcCCCCHHHHHHHHHHHHhccCccccceeehhhhCCHHHHHHHHHCHH
Confidence            45689999988888876553   321 25566666  999999999995


No 17 
>PF04285 DUF444:  Protein of unknown function (DUF444);  InterPro: IPR006698 This entry is represented by Thermus phage phiYS40, Orf56. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches [].
Probab=57.12  E-value=11  Score=38.02  Aligned_cols=10  Identities=30%  Similarity=0.368  Sum_probs=4.7

Q ss_pred             eeeecCCccc
Q 023124           59 TIEIPGKITE   68 (287)
Q Consensus        59 ~iei~g~it~   68 (287)
                      .|-||-+..+
T Consensus        51 ~V~IP~r~l~   60 (421)
T PF04285_consen   51 KVSIPIRGLE   60 (421)
T ss_pred             eEeecCCCCC
Confidence            3455544443


No 18 
>PRK05325 hypothetical protein; Provisional
Probab=56.80  E-value=12  Score=37.67  Aligned_cols=13  Identities=23%  Similarity=0.427  Sum_probs=7.6

Q ss_pred             ceeeecCCccccc
Q 023124           58 KTIEIPGKITEES   70 (287)
Q Consensus        58 ~~iei~g~it~ts   70 (287)
                      ..|-||-+++.+-
T Consensus        37 ~~v~IPi~~i~Ep   49 (401)
T PRK05325         37 EVVSIPIRDIDEP   49 (401)
T ss_pred             ceEEecCCCCccc
Confidence            4556666666544


No 19 
>PF08671 SinI:  Anti-repressor SinI;  InterPro: IPR010981 The SinR repressor is part of a group of Sin (sporulation inhibition) proteins in Bacillus subtilis that regulate the commitment to sporulation in response to extreme adversity []. SinR is a tetrameric repressor protein that binds to the promoters of genes essential for entry into sporulation and prevents their transcription. This repression is overcome through the activity of SinI, which disrupts the SinR tetramer through the formation of a SinI-SinR heterodimer, thereby allowing sporulation to proceed. The SinR structure consists of two domains: a dimerisation domain stabilised by a hydrophobic core, and a DNA-binding domain that is identical to domains of the bacteriophage 434 CI and Cro proteins that regulate prophage induction. The dimerisation domain is a four-helical bundle formed from two helices from the C-terminal residues of SinR and two helices from the central residues of SinI. These regions in SinR and SinI are similar in both structure and sequence. The interaction of SinR monomers to form tetramers is weaker than between SinR and SinI, since SinI can effectively disrupt SinR tetramers. This entry represents the dimerisation domain in both SinI and SinR proteins.; GO: 0005488 binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1B0N_A 2YAL_A.
Probab=53.34  E-value=10  Score=25.26  Aligned_cols=21  Identities=19%  Similarity=0.343  Sum_probs=14.4

Q ss_pred             HHHHHHHcCCCHHHHHHHHhhc
Q 023124          141 MMEAAKTVGIRKMFLLRYLDLQ  162 (287)
Q Consensus       141 l~~Aa~~g~is~a~L~Rfl~L~  162 (287)
                      |.+|.++| ++.+.+.+||..+
T Consensus         9 i~eA~~~G-ls~eeir~FL~~~   29 (30)
T PF08671_consen    9 IKEAKESG-LSKEEIREFLEFN   29 (30)
T ss_dssp             HHHHHHTT---HHHHHHHHHHH
T ss_pred             HHHHHHcC-CCHHHHHHHHHhC
Confidence            45655555 9999999999875


No 20 
>PRK05255 hypothetical protein; Provisional
Probab=45.35  E-value=1.4e+02  Score=26.85  Aligned_cols=17  Identities=35%  Similarity=0.307  Sum_probs=12.0

Q ss_pred             HHhhhhhhhhhc-Ccchh
Q 023124          173 RYCFMLRDRMLA-DPSFL  189 (287)
Q Consensus       173 r~~~g~r~RlLA-DP~Fl  189 (287)
                      +.+-.||+||++ |+.-+
T Consensus       107 h~lE~wRdrLi~~~d~al  124 (171)
T PRK05255        107 HKLERWRDRLLAEGDDAL  124 (171)
T ss_pred             HHHHHHHHHHHhCCHHHH
Confidence            345799999999 55433


No 21 
>PRK07772 single-stranded DNA-binding protein; Provisional
Probab=45.10  E-value=39  Score=30.59  Aligned_cols=6  Identities=17%  Similarity=0.573  Sum_probs=2.9

Q ss_pred             cccCCC
Q 023124            7 TFRLPN   12 (287)
Q Consensus         7 ~~~~~~   12 (287)
                      +|||-.
T Consensus        30 ~FrVAv   35 (186)
T PRK07772         30 NFTVAS   35 (186)
T ss_pred             EEEEEe
Confidence            455544


No 22 
>PLN03134 glycine-rich RNA-binding protein 4; Provisional
Probab=43.98  E-value=31  Score=29.27  Aligned_cols=8  Identities=13%  Similarity=0.389  Sum_probs=3.3

Q ss_pred             eeEeeccc
Q 023124           29 VFLSLRHS   36 (287)
Q Consensus        29 ~~~~~~~s   36 (287)
                      -|++|.+-
T Consensus        79 aFV~F~~~   86 (144)
T PLN03134         79 GFVNFNDE   86 (144)
T ss_pred             EEEEECCH
Confidence            34444433


No 23 
>KOG3074 consensus Transcriptional regulator of the PUR family, single-stranded-DNA-binding [Transcription]
Probab=42.90  E-value=15  Score=35.10  Aligned_cols=15  Identities=33%  Similarity=0.202  Sum_probs=9.3

Q ss_pred             cccccccHHHHHHHH
Q 023124          116 EFGPILKFEEVMKEI  130 (287)
Q Consensus       116 e~G~ll~~~~Vl~ea  130 (287)
                      --|++++-.||=+.+
T Consensus        45 ~rGRflKIaE~g~~~   59 (263)
T KOG3074|consen   45 PRGRFLKIAEVGAGG   59 (263)
T ss_pred             CCcceEEEEEeccCC
Confidence            467888776654433


No 24 
>PF07631 PSD4:  Protein of unknown function (DUF1592);  InterPro: IPR013042  A region of similarity shared by several Rhodopirellula baltica cytochrome-like proteins that are predicted to be secreted. These proteins also contain IPR011478 from INTERPRO, IPR013036 from INTERPRO, IPR013039 from INTERPRO and IPR013043 from INTERPRO.
Probab=42.46  E-value=96  Score=26.26  Aligned_cols=42  Identities=24%  Similarity=0.212  Sum_probs=28.2

Q ss_pred             HHHHHhcCCCch-HHHHHHHHHcCCC-HHHHHHHHhhcCCcchhHHHHHHhhhhhhhhhcCcch
Q 023124          127 MKEIELKGVGLP-DDMMEAAKTVGIR-KMFLLRYLDLQGSVWPLGFLMRYCFMLRDRMLADPSF  188 (287)
Q Consensus       127 l~ea~r~~~sLP-aDl~~Aa~~g~is-~a~L~Rfl~L~~sp~~l~~L~r~~~g~r~RlLADP~F  188 (287)
                      -+..+-=-.+.| +.|.+||+.|.++ +++                    ++.-.+|||+||.+
T Consensus         8 srLSYfLw~s~PD~~L~~aA~~g~L~~~~~--------------------l~~q~~RML~dpr~   51 (128)
T PF07631_consen    8 SRLSYFLWGSPPDAELLDAAAAGELRTPEQ--------------------LRAQAERMLADPRA   51 (128)
T ss_pred             HHHHHHHhcCCCCHHHHHHHHhCCCCCHHH--------------------HHHHHHHHHcCccH
Confidence            333344445667 6788999999885 332                    33556799999986


No 25 
>COG3028 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=41.35  E-value=77  Score=29.24  Aligned_cols=15  Identities=40%  Similarity=0.616  Sum_probs=10.4

Q ss_pred             HHHHhhhhhhhhhcC
Q 023124          171 LMRYCFMLRDRMLAD  185 (287)
Q Consensus       171 L~r~~~g~r~RlLAD  185 (287)
                      +.+++-.||+||+|+
T Consensus       115 ~lHklE~~RdrLia~  129 (187)
T COG3028         115 LLHKLEQLRDRLIAE  129 (187)
T ss_pred             HHHHHHHHHHHHHhc
Confidence            344457788888887


No 26 
>COG2718 Uncharacterized conserved protein [Function unknown]
Probab=38.85  E-value=50  Score=33.76  Aligned_cols=17  Identities=24%  Similarity=0.108  Sum_probs=10.8

Q ss_pred             ccccccHHHHHHHHHhc
Q 023124          117 FGPILKFEEVMKEIELK  133 (287)
Q Consensus       117 ~G~ll~~~~Vl~ea~r~  133 (287)
                      |=--.+.++++....+-
T Consensus       114 F~~~is~~e~~dllFed  130 (423)
T COG2718         114 FVFQISREEVLDLLFED  130 (423)
T ss_pred             hheeeehhHHHHHHHHH
Confidence            33456777777776554


No 27 
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification]
Probab=37.48  E-value=28  Score=32.78  Aligned_cols=18  Identities=17%  Similarity=0.433  Sum_probs=10.0

Q ss_pred             cceeeEeecccCCCCccc
Q 023124           26 PTTVFLSLRHSTATNPAL   43 (287)
Q Consensus        26 ~~~~~~~~~~s~~~~~~~   43 (287)
                      |...|++|.|.---.-+.
T Consensus        45 ppfafVeFEd~RDAeDAi   62 (241)
T KOG0105|consen   45 PPFAFVEFEDPRDAEDAI   62 (241)
T ss_pred             CCeeEEEecCccchhhhh
Confidence            555677777664433333


No 28 
>PRK07772 single-stranded DNA-binding protein; Provisional
Probab=36.29  E-value=47  Score=30.08  Aligned_cols=11  Identities=9%  Similarity=0.383  Sum_probs=4.8

Q ss_pred             CceeeecCCcc
Q 023124           57 PKTIEIPGKIT   67 (287)
Q Consensus        57 p~~iei~g~it   67 (287)
                      .-.|.|.|++.
T Consensus        74 Gd~V~V~GrL~   84 (186)
T PRK07772         74 GMRVIVTGRLK   84 (186)
T ss_pred             CCEEEEEEEEE
Confidence            33444444443


No 29 
>TIGR02877 spore_yhbH sporulation protein YhbH. This protein family, typified by YhbH in Bacillus subtilis, is found in nearly every endospore-forming bacterium and in no other genome (but note that the trusted cutoff score is set high to exclude a single high-scoring sequence from Nitrosococcus oceani ATCC 19707, which is classified in the Gammaproteobacteria). The gene in Bacillus subtilis was shown to be in the regulon of the sporulation sigma factor, sigma-E, and its mutation was shown to create a sporulation defect.
Probab=35.35  E-value=37  Score=34.09  Aligned_cols=14  Identities=29%  Similarity=0.332  Sum_probs=8.1

Q ss_pred             CceeeecCCccccc
Q 023124           57 PKTIEIPGKITEES   70 (287)
Q Consensus        57 p~~iei~g~it~ts   70 (287)
                      .-.|-||-++..+-
T Consensus        48 ~~~V~IPir~l~Ep   61 (371)
T TIGR02877        48 KKKIKVPIRGLKEY   61 (371)
T ss_pred             CceEEccCCCCccc
Confidence            34566666666554


No 30 
>COG2718 Uncharacterized conserved protein [Function unknown]
Probab=35.31  E-value=29  Score=35.40  Aligned_cols=11  Identities=55%  Similarity=0.996  Sum_probs=5.3

Q ss_pred             CCCCCCCCCCC
Q 023124          102 GGGGDGEGNDG  112 (287)
Q Consensus       102 gg~g~g~~~d~  112 (287)
                      +|.|+|+++|+
T Consensus       103 ~~ag~~egED~  113 (423)
T COG2718         103 QAAGDGEGEDE  113 (423)
T ss_pred             CccCCCCCcch
Confidence            34445555543


No 31 
>PRK12799 motB flagellar motor protein MotB; Reviewed
Probab=34.70  E-value=31  Score=35.07  Aligned_cols=26  Identities=15%  Similarity=0.292  Sum_probs=23.9

Q ss_pred             hHHHHHHHHHHHHHHHHHhHhhcccc
Q 023124          218 EFELYLADLLVGLVVDIALVGMLAPY  243 (287)
Q Consensus       218 ElDfV~adlv~~~i~nfaLV~lLAPt  243 (287)
                      .|=..++|+++++.+=|+|+|+++=+
T Consensus        26 aWkVAYADfvTlLMAFFlLLwsmSsv   51 (421)
T PRK12799         26 SWKIAYADFMTAMMAFFLVMWLLAVS   51 (421)
T ss_pred             chhhhHHHHHHHHHHHHHHHHHhhcC
Confidence            69999999999999999999998743


No 32 
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification]
Probab=34.51  E-value=31  Score=35.34  Aligned_cols=56  Identities=21%  Similarity=0.226  Sum_probs=28.5

Q ss_pred             hHHHHHHHHHcC---------CCHHHHHHHHhhcCCcch-------------hHHHHHHh-hhhhhhhhcCcchhHHHh
Q 023124          138 PDDMMEAAKTVG---------IRKMFLLRYLDLQGSVWP-------------LGFLMRYC-FMLRDRMLADPSFLFKVG  193 (287)
Q Consensus       138 PaDl~~Aa~~g~---------is~a~L~Rfl~L~~sp~~-------------l~~L~r~~-~g~r~RlLADP~FlfKl~  193 (287)
                      -+|+.+|++..+         -...+|+.|=+++..-.-             -..|+..- +.-.+|+--|++=+-||+
T Consensus        45 eadl~eal~~fG~i~yvt~~P~~r~alvefedi~~akn~Vnfaa~n~i~i~gq~Al~NyStsq~i~R~g~es~~pN~VL  123 (494)
T KOG1456|consen   45 EADLVEALSNFGPIAYVTCMPHKRQALVEFEDIEGAKNCVNFAADNQIYIAGQQALFNYSTSQCIERPGDESATPNKVL  123 (494)
T ss_pred             hhHHHHHHhcCCceEEEEeccccceeeeeeccccchhhheehhccCcccccCchhhcccchhhhhccCCCCCCCCCeEE
Confidence            367777776643         234456666555543100             02333322 555667766666555554


No 33 
>PF13677 MotB_plug:  Membrane MotB of proton-channel complex MotA/MotB 
Probab=33.27  E-value=52  Score=24.28  Aligned_cols=27  Identities=19%  Similarity=0.198  Sum_probs=23.7

Q ss_pred             hhHHHHHHHHHHHHHHHHHhHhhcccc
Q 023124          217 SEFELYLADLLVGLVVDIALVGMLAPY  243 (287)
Q Consensus       217 ~ElDfV~adlv~~~i~nfaLV~lLAPt  243 (287)
                      ..|-+-++|+++.+.+=|+++|.++-.
T Consensus        15 ~~WlvtyaDlmTLLl~fFVlL~s~s~~   41 (58)
T PF13677_consen   15 PRWLVTYADLMTLLLAFFVLLFSMSSV   41 (58)
T ss_pred             ccHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence            369999999999999999999987654


No 34 
>TIGR03795 chp_BMA0021 conserved hypothetical protein, BMA_0021 family. Members of this protein family are found sparsely, mostly in members of the genus Burkholderia. Members often occur as tandem homologous genes, such as BMA_0021 and BMA_0022 in Burkholderia mallei ATCC 23344. The genes regularly are encoded near the so-called docking protein of TOMM (thiazole/oxazole-modified microcins) biosynthetic clusters, suggesting a role in bacteriocin biosynthesis. The function is unknown.
Probab=31.83  E-value=31  Score=29.39  Aligned_cols=28  Identities=25%  Similarity=0.322  Sum_probs=20.9

Q ss_pred             HHhhcCCcchhHHHHHHh--hhhhhhhhcCcc
Q 023124          158 YLDLQGSVWPLGFLMRYC--FMLRDRMLADPS  187 (287)
Q Consensus       158 fl~L~~sp~~l~~L~r~~--~g~r~RlLADP~  187 (287)
                      ||++.+  ..+|.+.+++  ..||+||++||.
T Consensus        10 ll~f~~--v~lraIA~AW~DpaFr~eLl~DPk   39 (114)
T TIGR03795        10 LLEFRA--VYLRAIALAWHSPEFKDELLADPV   39 (114)
T ss_pred             HHHHHH--HHHHHHHHHhCCHHHHHHHHHCHH
Confidence            344443  3468888887  899999999995


No 35 
>TIGR01323 nitrile_alph nitrile hydratase, alpha subunit. This model describes both iron- and cobalt-containing nitrile hydratase alpha chains. It excludes the thiocyanate hydrolase gamma subunit of Thiobacillus thioparus, a sequence that appears to have evolved from within the family of nitrile hydratase alpha subunits but which differs by several indels and a more rapid accumulation of point mutations.
Probab=29.94  E-value=52  Score=30.29  Aligned_cols=43  Identities=12%  Similarity=-0.048  Sum_probs=30.6

Q ss_pred             HHHcCCCHHHHHHHHhhcCC---cc-hhHHHHHHh--hhhhhhhhcCcc
Q 023124          145 AKTVGIRKMFLLRYLDLQGS---VW-PLGFLMRYC--FMLRDRMLADPS  187 (287)
Q Consensus       145 a~~g~is~a~L~Rfl~L~~s---p~-~l~~L~r~~--~g~r~RlLADP~  187 (287)
                      ++.|.|.++.+.+.++....   |. =.+-+.|++  +.||.|||+|..
T Consensus        11 ~eKGli~~~~id~~i~~~~~~~gP~nGA~vVArAW~Dp~fk~~Ll~d~~   59 (185)
T TIGR01323        11 KSKGLIPEGAVDQLTSLYENEWGPENGAKVVAKAWVDPEFRALLLKDAT   59 (185)
T ss_pred             HHcCCCCHHHHHHHHHHHHhccCCcchhhhhhHHhcCHHHHHHHHhChH
Confidence            45688888888777765443   31 125566777  999999999984


No 36 
>PF00813 FliP:  FliP family;  InterPro: IPR005838 Secretion of virulence factors in Gram-negative bacteria involves transportation of the protein across two membranes to reach the cell exterior []. There have been four secretion systems described in animal enteropathogens such as Salmonella and Yersinia, with further sequence similarities in plant pathogens like Ralstonia and Erwinia. The type III secretion system is of great interest as it is used to transport virulence factors from the pathogen directly into the host cell [] and is only triggered when the bacterium comes into close contact with the host. The protein subunits of the system are very similar to those of bacterial flagellar biosynthesis []. However, while the latter forms a ring structure to allow secretion of flagellin and is an integral part of the flagellum itself [], type III subunits in the outer membrane translocate secreted proteins through a channel-like structure. It is believed that the family of type III inner membrane proteins are used as structural moieties in a complex with several other subunits [], including the ATPase necessary for driving the secretion system. One such set of inner membrane proteins, termed "P" here for nomenclature purposes, includes the Salmonella and Shigella SpaP, the Yersinia YscR, the Erwinia HrcR, and the Xanthamonas Pro2 genes [], as well as several FliP flagellar biosynthesis genes []. FliP is an ~30Kd protein containing three or four transmembrane (TM) regions.; GO: 0009306 protein secretion, 0016020 membrane
Probab=28.85  E-value=2.9e+02  Score=25.57  Aligned_cols=28  Identities=21%  Similarity=0.268  Sum_probs=23.9

Q ss_pred             HHHHHHHHHHHHHHHHHhHhhccccccc
Q 023124          219 FELYLADLLVGLVVDIALVGMLAPYARI  246 (287)
Q Consensus       219 lDfV~adlv~~~i~nfaLV~lLAPt~s~  246 (287)
                      +=|++.|++++.|+=.+=+-|+.|+.-.
T Consensus       145 lPFlvIDlvVasiLmamGMmMl~P~~IS  172 (194)
T PF00813_consen  145 LPFLVIDLVVASILMAMGMMMLPPVTIS  172 (194)
T ss_pred             HHHHHHHHHHHHHHHHhhhhhcCchHHH
Confidence            5688899999999999999999998643


No 37 
>PF10415 FumaraseC_C:  Fumarase C C-terminus;  InterPro: IPR018951  Fumarase C catalyses the stereo-specific interconversion of fumarate to L-malate as part of the Krebs cycle. The full-length protein forms a tetramer with visible globular shape. FumaraseC_C is the C-terminal 65 residues referred to as domain 3. The core of the molecule consists of a bundle of 20 alpha-helices from the five-helix bundle of domain 2. The projections from the core of the tetramer are generated from domains 1 and 3 of each subunit []. This entry does not appear to be part of either the active site or the activation site but is helical in structure forming a little bundle. ; GO: 0016829 lyase activity, 0006099 tricarboxylic acid cycle; PDB: 3RRP_A 3OCE_D 3OCF_D 3E04_B 3GTD_A 3R6V_F 3R6Q_F 1J3U_B 1FUR_A 1YFE_A ....
Probab=28.62  E-value=75  Score=23.36  Aligned_cols=37  Identities=19%  Similarity=0.118  Sum_probs=27.1

Q ss_pred             HHHHHHHHHhcCCCchHHHHHHHHHcCCCHHHHHHHHhhc
Q 023124          123 FEEVMKEIELKGVGLPDDMMEAAKTVGIRKMFLLRYLDLQ  162 (287)
Q Consensus       123 ~~~Vl~ea~r~~~sLPaDl~~Aa~~g~is~a~L~Rfl~L~  162 (287)
                      ..+|-++|.+++.++..-.   .+.|.++++++.+.|+.+
T Consensus        14 aa~iAk~A~~~g~svre~v---~~~g~lt~ee~d~ll~p~   50 (55)
T PF10415_consen   14 AAEIAKEALAEGRSVREVV---LEEGLLTEEELDELLDPE   50 (55)
T ss_dssp             HHHHHHHHHHHT--HHHHH---HHTTSS-HHHHHHHTSHH
T ss_pred             HHHHHHHHHHcCCCHHHHH---HHcCCCCHHHHHHHcCHH
Confidence            4678889999999886544   467889999999998865


No 38 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=27.54  E-value=77  Score=31.12  Aligned_cols=7  Identities=0%  Similarity=0.359  Sum_probs=2.9

Q ss_pred             eeeecCC
Q 023124           59 TIEIPGK   65 (287)
Q Consensus        59 ~iei~g~   65 (287)
                      -+-||-+
T Consensus       224 dLSmStR  230 (314)
T PF06524_consen  224 DLSMSTR  230 (314)
T ss_pred             cceeeee
Confidence            3444433


No 39 
>PF02422 Keratin:  Keratin;  InterPro: IPR003461 Keratins are a well known group of intermediate filament proteins. Like actin filaments, keratins are flexible but provide a firm cell skeleton. Unlike actin, however, no known keratins are associated with motor functions. This family represents avian keratin proteins [], found in feathers, scale and claw. The avian keratins (F-ker, S-ker, C-ker and B-ker) are a complex mixture of very similar polypeptides.; GO: 0005200 structural constituent of cytoskeleton, 0005882 intermediate filament
Probab=24.40  E-value=1.4e+02  Score=25.04  Aligned_cols=31  Identities=23%  Similarity=0.509  Sum_probs=20.6

Q ss_pred             ccccccCCCC--CCCCceeeecCCcccccCCCC
Q 023124           44 CKLQCVGNNF--DSTPKTIEIPGKITEESADCE   74 (287)
Q Consensus        44 ~~~~c~~~~~--~~~p~~iei~g~it~ts~~~~   74 (287)
                      |..||--+.-  ...||-|.++|-|.-+.++..
T Consensus        24 Cv~QcpdS~vvIqPppvVVTlPGPILSs~pQ~~   56 (98)
T PF02422_consen   24 CVRQCPDSEVVIQPPPVVVTLPGPILSSFPQPS   56 (98)
T ss_pred             HHhhCCCceEEEcCCCEEEeccCcccccCCccc
Confidence            4777763321  235788899999988776443


No 40 
>KOG3074 consensus Transcriptional regulator of the PUR family, single-stranded-DNA-binding [Transcription]
Probab=24.36  E-value=47  Score=31.92  Aligned_cols=10  Identities=40%  Similarity=0.547  Sum_probs=4.0

Q ss_pred             HHHHHHHHHH
Q 023124          225 DLLVGLVVDI  234 (287)
Q Consensus       225 dlv~~~i~nf  234 (287)
                      |+|+-++.||
T Consensus       159 daLaelle~~  168 (263)
T KOG3074|consen  159 DALAELLEDF  168 (263)
T ss_pred             HHHHHHHHHh
Confidence            3333344443


No 41 
>TIGR00625 tfb2 Transcription factor tfb2. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=24.01  E-value=79  Score=32.53  Aligned_cols=67  Identities=13%  Similarity=0.133  Sum_probs=44.8

Q ss_pred             HHHHHHHhcCCCch---------HHHHHHHHHcCCCHHHHHHHHhhcCCcchhH--------HHHHH---hhhhhhhhhc
Q 023124          125 EVMKEIELKGVGLP---------DDMMEAAKTVGIRKMFLLRYLDLQGSVWPLG--------FLMRY---CFMLRDRMLA  184 (287)
Q Consensus       125 ~Vl~ea~r~~~sLP---------aDl~~Aa~~g~is~a~L~Rfl~L~~sp~~l~--------~L~r~---~~g~r~RlLA  184 (287)
                      ++++.--+-...+|         ..+++|.+.| |+..|+.+||.-.+.|...+        -++..   |..=|+|+-.
T Consensus       313 ~il~lF~~~~~r~pnlvvg~iTr~Sv~~A~~~G-ITa~qIi~fl~~~ahp~~~~~~~~~lP~tv~dQi~lWe~e~~R~~~  391 (448)
T TIGR00625       313 ALIALFSELLARFPNMVVGQITRESIRRALANG-ITAQQIIHYLRTHAHPQMRKEQTPVLPPTIVDQIRLWELERDRLRF  391 (448)
T ss_pred             HHHHHHHHHHhcCCceEEEEecHHHHHHHHHcC-CCHHHHHHHHHhcCChhhhccCCCCCChHHHHHHHHHHHHhcceEe
Confidence            45555444444444         4567888777 99999999999888764211        23333   3444889999


Q ss_pred             CcchhHHH
Q 023124          185 DPSFLFKV  192 (287)
Q Consensus       185 DP~FlfKl  192 (287)
                      .|.||||=
T Consensus       392 ~~~~l~~~  399 (448)
T TIGR00625       392 TEGVLYND  399 (448)
T ss_pred             ecceeeee
Confidence            98888764


No 42 
>PF15207 TMEM240:  TMEM240 family
Probab=23.94  E-value=88  Score=28.27  Aligned_cols=26  Identities=35%  Similarity=0.365  Sum_probs=21.1

Q ss_pred             cchhhHHHHHHHHHHHHHHHHHhHhhc
Q 023124          214 DFWSEFELYLADLLVGLVVDIALVGML  240 (287)
Q Consensus       214 ~f~~ElDfV~adlv~~~i~nfaLV~lL  240 (287)
                      --++|+|+++ -++++.+..-+||||=
T Consensus        83 vtkqeidlml-glllgfcisw~l~wmd  108 (180)
T PF15207_consen   83 VTKQEIDLML-GLLLGFCISWFLVWMD  108 (180)
T ss_pred             chHHHHHHHH-HHHHHHHHHHHHHHHh
Confidence            3478999987 4788888899999983


No 43 
>PRK06925 flagellar motor protein MotS; Reviewed
Probab=23.51  E-value=72  Score=28.99  Aligned_cols=26  Identities=15%  Similarity=0.257  Sum_probs=23.8

Q ss_pred             hhHHHHHHHHHHHHHHHHHhHhhccc
Q 023124          217 SEFELYLADLLVGLVVDIALVGMLAP  242 (287)
Q Consensus       217 ~ElDfV~adlv~~~i~nfaLV~lLAP  242 (287)
                      .+|-.-++|++|.+.+=|+|+|.++=
T Consensus        13 ~~W~vtyaD~~TlLlafFvlL~s~s~   38 (230)
T PRK06925         13 PKWMVTFSDLITLILVFFILLFSMSQ   38 (230)
T ss_pred             cchhhhHHHHHHHHHHHHHHHHHhhc
Confidence            47999999999999999999999874


No 44 
>TIGR03793 TOMM_pelo TOMM propeptide domain. This model represents a domain that is conserved among a large number of putative thiazole/oxazole-modified microcins (TOMM). Oddly, most of this seqence region appears homologous to nitrile hydratase subunits. This family is expanded especially in Pelotomaculum thermopropionicum SI.
Probab=23.25  E-value=50  Score=26.02  Aligned_cols=17  Identities=12%  Similarity=0.380  Sum_probs=13.4

Q ss_pred             HHHHh--hhhhhhhhcCcc
Q 023124          171 LMRYC--FMLRDRMLADPS  187 (287)
Q Consensus       171 L~r~~--~g~r~RlLADP~  187 (287)
                      +.|++  +.||.||++||.
T Consensus        10 varAw~Dp~Fr~~Ll~DPr   28 (77)
T TIGR03793        10 IAKAWEDEAFKQALLTNPK   28 (77)
T ss_pred             HHHHHcCHHHHHHHHHCHH
Confidence            34444  899999999995


No 45 
>PRK09038 flagellar motor protein MotD; Reviewed
Probab=22.91  E-value=75  Score=29.98  Aligned_cols=26  Identities=12%  Similarity=0.163  Sum_probs=23.7

Q ss_pred             hhHHHHHHHHHHHHHHHHHhHhhccc
Q 023124          217 SEFELYLADLLVGLVVDIALVGMLAP  242 (287)
Q Consensus       217 ~ElDfV~adlv~~~i~nfaLV~lLAP  242 (287)
                      .+|-.-++|+++++.+=|+|+|.++=
T Consensus        15 ~~WlvtYAD~mTLLlaFFVlL~smS~   40 (281)
T PRK09038         15 ERWLVSYADFITLLFAFFVVMYAISS   40 (281)
T ss_pred             cchhhhHHHHHHHHHHHHHHHHHHhc
Confidence            37999999999999999999998873


No 46 
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification]
Probab=22.83  E-value=1.9e+02  Score=27.43  Aligned_cols=12  Identities=8%  Similarity=0.097  Sum_probs=6.7

Q ss_pred             CCCcccccCCCC
Q 023124           72 DCEPRIHSSGGD   83 (287)
Q Consensus        72 ~~~~~~~~~~G~   83 (287)
                      +.++|.+-++..
T Consensus        74 rLRVEfprggr~   85 (241)
T KOG0105|consen   74 RLRVEFPRGGRS   85 (241)
T ss_pred             eEEEEeccCCCc
Confidence            455666655553


No 47 
>PRK07734 motB flagellar motor protein MotB; Reviewed
Probab=22.05  E-value=72  Score=29.52  Aligned_cols=26  Identities=19%  Similarity=0.203  Sum_probs=23.7

Q ss_pred             hhHHHHHHHHHHHHHHHHHhHhhccc
Q 023124          217 SEFELYLADLLVGLVVDIALVGMLAP  242 (287)
Q Consensus       217 ~ElDfV~adlv~~~i~nfaLV~lLAP  242 (287)
                      ..|-.-++|++|++.+=|+|+|.++=
T Consensus        17 ~~W~vtYAD~vTlLlaFFvlL~s~s~   42 (259)
T PRK07734         17 ESWLIPYADLLTLLLALFIVLFAMSS   42 (259)
T ss_pred             CcchhhHHHHHHHHHHHHHHHHHHhh
Confidence            36999999999999999999999873


No 48 
>KOG3570 consensus MAPK-activating protein DENN [Signal transduction mechanisms]
Probab=21.57  E-value=1.7e+02  Score=33.56  Aligned_cols=71  Identities=21%  Similarity=0.291  Sum_probs=37.5

Q ss_pred             CCCCc-ccccc--eeeEeecccCCCCcccccccccCCCCCCCCceeeecCCccccc---------CCCCcccccCCCCCC
Q 023124           18 PQNHN-IVMPT--TVFLSLRHSTATNPALCKLQCVGNNFDSTPKTIEIPGKITEES---------ADCEPRIHSSGGDGG   85 (287)
Q Consensus        18 ~~~~~-~~~~~--~~~~~~~~s~~~~~~~~~~~c~~~~~~~~p~~iei~g~it~ts---------~~~~~~~~~~~G~Gg   85 (287)
                      |..|. ..+|+  ++||.=.--+...|+.-.      -+|-+-|-..+.-|++--.         ...+.++.+-.|.||
T Consensus        40 ~~DH~dFpLP~Dvv~FCQPEGCtsv~~Rr~~------~rD~tsFVF~LTdKDsgktRYGICvNFYrsf~~r~s~~~g~~g  113 (1588)
T KOG3570|consen   40 LEDHTEFPLPPDVVFFCQPEGCLSVRQRRMS------LRDDTSFVFTLTDKDTGVTRYGICVNFYRSFQKRISKEKGEGG  113 (1588)
T ss_pred             ccccccCCCCCCeEEEeCCccccchhhhhhc------ccCCceEEEEEecccCcceeeEEEeeeehhhhhccchhccccc
Confidence            44453 34554  678876666655665522      2234445555555554322         345556666667776


Q ss_pred             CCCCCCCCC
Q 023124           86 AGDSPGGGG   94 (287)
Q Consensus        86 ~g~~~~~gg   94 (287)
                      .|..|+-|+
T Consensus       114 ag~Rg~~g~  122 (1588)
T KOG3570|consen  114 AGSRGKEGT  122 (1588)
T ss_pred             cccCCCCCC
Confidence            666544333


No 49 
>TIGR01659 sex-lethal sex-lethal family splicing factor. This model describes the sex-lethal family of splicing factors found in Dipteran insects. The sex-lethal phenotype, however, may be limited to the Melanogasters and closely related species. In Drosophila the protein acts as an inhibitor of splicing. This subfamily is most closely related to the ELAV/HUD subfamily of splicing factors (TIGR01661).
Probab=20.91  E-value=1e+02  Score=30.02  Aligned_cols=6  Identities=17%  Similarity=0.733  Sum_probs=2.9

Q ss_pred             ceeeEe
Q 023124           27 TTVFLS   32 (287)
Q Consensus        27 ~~~~~~   32 (287)
                      +++|+.
T Consensus       194 ~~lfV~  199 (346)
T TIGR01659       194 TNLYVT  199 (346)
T ss_pred             ceeEEe
Confidence            445554


No 50 
>PF05084 GRA6:  Granule antigen protein (GRA6);  InterPro: IPR008119  Toxoplasma gondii is an obligate intracellular apicomplexan protozoan parasite, with a complex lifestyle involving varied hosts []. It has two phases of growth: an intestinal phase in feline hosts, and an extra-intestinal phase in other mammals. Oocysts from infected cats develop into tachyzoites, and eventually, bradyzoites and zoitocysts in the extraintestinal host []. Transmission of the parasite occurs through contact with infected cats or raw/undercooked meat; in immunocompromised individuals, it can cause severe and often lethal toxoplasmosis. Acute infection in healthy humans can sometimes also cause tissue damage [].  The protozoan utilises a variety of secretory and antigenic proteins to invade a host and gain access to the intracellular environment []. These originate from distinct organelles in the T. gondii cell termed micronemes, rhoptries, and dense granules. They are released at specific times during invasion to ensure the proteins are allocated to their correct target destinations []. Dense granule antigens (GRAs) are released from the T. gondii tachyzoite while still encapsulated in a host vacuole. Gra6, one of these moieties, is associated with the parasitophorous vacuole []. It possesses a hydrophobic central region flanked by two hydrophilic domains, and is present as a single copy gene in the Toxoplasma gondii genome []. Gra6 shares a similar function with Gra2, in that it is rapidly targeted to a network of membranous tubules that connect with the vacuolar membrane []. Indeed, these two proteins, together with Gra4, form a multimeric complex that stabilises the parasite within the vacuole.
Probab=20.35  E-value=1.4e+02  Score=27.74  Aligned_cols=20  Identities=30%  Similarity=0.328  Sum_probs=9.3

Q ss_pred             cccceeeEeecccCCCCccc
Q 023124           24 VMPTTVFLSLRHSTATNPAL   43 (287)
Q Consensus        24 ~~~~~~~~~~~~s~~~~~~~   43 (287)
                      |-|..|.-+=+.+-..-|.+
T Consensus       100 V~P~~V~~~E~~s~a~~~~~  119 (215)
T PF05084_consen  100 VDPFPVLANEGKSEARGPSQ  119 (215)
T ss_pred             CCccccccccccCccccchH
Confidence            34444444444444444444


No 51 
>PF12244 DUF3606:  Protein of unknown function (DUF3606);  InterPro: IPR022037  This family of proteins is found in bacteria. Proteins in this family are typically between 58 and 85 amino acids in length. There is a single completely conserved residue G that may be functionally important. 
Probab=20.21  E-value=1.9e+02  Score=21.37  Aligned_cols=34  Identities=18%  Similarity=0.183  Sum_probs=28.2

Q ss_pred             HHHHHhcCCCchHHHHHHHHHcCCCHHHHHHHHh
Q 023124          127 MKEIELKGVGLPDDMMEAAKTVGIRKMFLLRYLD  160 (287)
Q Consensus       127 l~ea~r~~~sLPaDl~~Aa~~g~is~a~L~Rfl~  160 (287)
                      ++-|.++.--=++.|++|++.-|-+.+.+.+||.
T Consensus        23 v~ywa~~~gvt~~~L~~AV~~vG~~~~~V~~~L~   56 (57)
T PF12244_consen   23 VRYWAKRFGVTEEQLREAVRAVGNSRAAVRAYLG   56 (57)
T ss_pred             HHHHHHHHCcCHHHHHHHHHHHCcCHHHHHHHHc
Confidence            4566666666689999999999999999999984


No 52 
>PRK06958 single-stranded DNA-binding protein; Provisional
Probab=20.06  E-value=1.1e+02  Score=27.87  Aligned_cols=11  Identities=27%  Similarity=0.516  Sum_probs=4.8

Q ss_pred             CceeeecCCcc
Q 023124           57 PKTIEIPGKIT   67 (287)
Q Consensus        57 p~~iei~g~it   67 (287)
                      .-.|.|+|++.
T Consensus        73 Gs~V~VeGrL~   83 (182)
T PRK06958         73 GSSVYIEGRIR   83 (182)
T ss_pred             CCEEEEEEEEE
Confidence            33444444443


Done!