BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 023125
         (287 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3TON|A Chain A, Crystral Structure Of The C-Terminal Subunit Of Human
           Maltase- Glucoamylase
 pdb|3TON|B Chain B, Crystral Structure Of The C-Terminal Subunit Of Human
           Maltase- Glucoamylase
 pdb|3TOP|A Chain A, Crystral Structure Of The C-Terminal Subunit Of Human
           Maltase- Glucoamylase In Complex With Acarbose
 pdb|3TOP|B Chain B, Crystral Structure Of The C-Terminal Subunit Of Human
           Maltase- Glucoamylase In Complex With Acarbose
          Length = 908

 Score = 28.5 bits (62), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 144 ICRYNGQRENETASNDMVLSTAEVDFDVSKSDV 176
           +CRY  Q ++E AS    +  A++ +DV  SD+
Sbjct: 297 LCRYGYQNDSEIASLYDEMVAAQIPYDVQYSDI 329


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.315    0.131    0.381 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,764,377
Number of Sequences: 62578
Number of extensions: 280174
Number of successful extensions: 600
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 598
Number of HSP's gapped (non-prelim): 5
length of query: 287
length of database: 14,973,337
effective HSP length: 98
effective length of query: 189
effective length of database: 8,840,693
effective search space: 1670890977
effective search space used: 1670890977
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (24.3 bits)