BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 023151
(286 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3M03|A Chain A, Crystal Structure Of Human Orc6 Fragment
pdb|3M03|B Chain B, Crystal Structure Of Human Orc6 Fragment
pdb|3M03|C Chain C, Crystal Structure Of Human Orc6 Fragment
Length = 95
Score = 40.0 bits (92), Expect = 0.002, Method: Compositional matrix adjust.
Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 4/56 (7%)
Query: 92 NELDIRELGIRFGCIRLIPLVQKGLSLFKDRFTAALPASRKTSADFSRPVFTAVAF 147
+ + IR+L ++F CI + + K L + ++LP +++ D SRP+FT+ A
Sbjct: 2 SNIGIRDLAVQFSCIEAVNMASKILK----SYESSLPQTQQVDLDLSRPLFTSAAL 53
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.132 0.369
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,049,001
Number of Sequences: 62578
Number of extensions: 247081
Number of successful extensions: 595
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 591
Number of HSP's gapped (non-prelim): 5
length of query: 286
length of database: 14,973,337
effective HSP length: 98
effective length of query: 188
effective length of database: 8,840,693
effective search space: 1662050284
effective search space used: 1662050284
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)