BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 023152
(286 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2QLV|A Chain A, Crystal Structure Of The Heterotrimer Core Of The S.
Cerevisiae Ampk Homolog Snf1
pdb|2QLV|D Chain D, Crystal Structure Of The Heterotrimer Core Of The S.
Cerevisiae Ampk Homolog Snf1
Length = 171
Score = 28.5 bits (62), Expect = 4.8, Method: Compositional matrix adjust.
Identities = 12/31 (38%), Positives = 18/31 (58%)
Query: 253 VRWKYDLGRKKNFEQVYPVQLHLWLQELQNE 283
+RWKYD+G K N + P + + +Q Q E
Sbjct: 87 LRWKYDIGNKTNTNEKIPDLMKMVIQLFQIE 117
>pdb|3T4N|A Chain A, Structure Of The Regulatory Fragment Of Saccharomyces
Cerevisiae Ampk In Complex With Adp
pdb|3TDH|A Chain A, Structure Of The Regulatory Fragment Of Sccharomyces
Cerevisiae Ampk In Complex With Amp
pdb|3TE5|A Chain A, Structure Of The Regulatory Fragment Of Sacchromyces
Cerevisiae Ampk In Complex With Nadh
Length = 179
Score = 28.1 bits (61), Expect = 5.3, Method: Compositional matrix adjust.
Identities = 12/31 (38%), Positives = 18/31 (58%)
Query: 253 VRWKYDLGRKKNFEQVYPVQLHLWLQELQNE 283
+RWKYD+G K N + P + + +Q Q E
Sbjct: 92 LRWKYDIGNKTNTNEKIPDLMKMVIQLFQIE 122
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.328 0.140 0.460
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,232,349
Number of Sequences: 62578
Number of extensions: 228537
Number of successful extensions: 520
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 516
Number of HSP's gapped (non-prelim): 4
length of query: 286
length of database: 14,973,337
effective HSP length: 98
effective length of query: 188
effective length of database: 8,840,693
effective search space: 1662050284
effective search space used: 1662050284
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)